Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8Q4N4

Protein Details
Accession F8Q4N4    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAPAKTAKTENKPKKEKVFHPESRKAGHydrophilic
NLS Segment(s)
PositionSequence
10-49ENKPKKEKVFHPESRKAGQISRSHFRKGKLSEAASKRNKK
96-107AARRKGRPKSTK
Subcellular Location(s) nucl 15, cyto_nucl 11.833, mito_nucl 10.333, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021346  Tma16  
IPR038356  Tma16_sf  
Pfam View protein in Pfam  
PF11176  Tma16  
Amino Acid Sequences MAPAKTAKTENKPKKEKVFHPESRKAGQISRSHFRKGKLSEAASKRNKKQLAQADVYGFFYHAIPPEGVLSLEDLHSIVRDVWLVRHDVELEHERAARRKGRPKSTKEMKLEEIKLREAEEYRTGMEVPDLTHEPTVELFRRWDQKEVAFIYLLRFVRISGAEPTVTILSRPGTHHTVSLVHLAPIVSSTYCINTGSSIKNPSLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.85
4 0.84
5 0.84
6 0.83
7 0.84
8 0.84
9 0.79
10 0.73
11 0.69
12 0.62
13 0.56
14 0.54
15 0.51
16 0.49
17 0.53
18 0.53
19 0.56
20 0.57
21 0.55
22 0.57
23 0.54
24 0.55
25 0.53
26 0.53
27 0.55
28 0.58
29 0.65
30 0.66
31 0.71
32 0.68
33 0.69
34 0.69
35 0.61
36 0.64
37 0.63
38 0.61
39 0.56
40 0.53
41 0.47
42 0.44
43 0.43
44 0.34
45 0.24
46 0.17
47 0.13
48 0.11
49 0.1
50 0.1
51 0.09
52 0.09
53 0.09
54 0.09
55 0.09
56 0.08
57 0.08
58 0.07
59 0.07
60 0.06
61 0.06
62 0.05
63 0.05
64 0.06
65 0.05
66 0.05
67 0.05
68 0.05
69 0.07
70 0.08
71 0.09
72 0.09
73 0.1
74 0.1
75 0.09
76 0.12
77 0.14
78 0.14
79 0.14
80 0.15
81 0.16
82 0.18
83 0.23
84 0.25
85 0.29
86 0.37
87 0.44
88 0.53
89 0.61
90 0.64
91 0.71
92 0.74
93 0.76
94 0.72
95 0.68
96 0.62
97 0.59
98 0.57
99 0.51
100 0.43
101 0.35
102 0.31
103 0.28
104 0.25
105 0.19
106 0.18
107 0.16
108 0.15
109 0.14
110 0.14
111 0.13
112 0.12
113 0.11
114 0.09
115 0.07
116 0.09
117 0.1
118 0.1
119 0.1
120 0.1
121 0.1
122 0.11
123 0.14
124 0.12
125 0.12
126 0.14
127 0.18
128 0.26
129 0.28
130 0.31
131 0.3
132 0.3
133 0.35
134 0.35
135 0.32
136 0.25
137 0.23
138 0.21
139 0.25
140 0.23
141 0.17
142 0.15
143 0.14
144 0.16
145 0.16
146 0.17
147 0.13
148 0.15
149 0.14
150 0.14
151 0.16
152 0.15
153 0.14
154 0.12
155 0.11
156 0.11
157 0.14
158 0.16
159 0.19
160 0.22
161 0.22
162 0.23
163 0.24
164 0.24
165 0.23
166 0.26
167 0.22
168 0.18
169 0.18
170 0.17
171 0.15
172 0.14
173 0.14
174 0.09
175 0.09
176 0.1
177 0.11
178 0.12
179 0.13
180 0.13
181 0.14
182 0.18
183 0.22
184 0.26
185 0.28