Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8QC39

Protein Details
Accession F8QC39    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
19-46ASTKSPSISKAPPKRRRRAPSPSQWIPTHydrophilic
NLS Segment(s)
PositionSequence
28-37KAPPKRRRRA
Subcellular Location(s) nucl 13, mito_nucl 10.833, cyto_nucl 8.333, mito 7.5, plas 3
Family & Domain DBs
Amino Acid Sequences MGDPCSSSPSGPSSPSQSASTKSPSISKAPPKRRRRAPSPSQWIPTSLLPFKILPMEFIKSTSVPLPPVSAYKDETTDEWIEERDSWDESVGVTPYHPCAWKGKLPGPGLGFGGRDLSNLGLVGGSGFVMGRLVML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.34
4 0.31
5 0.32
6 0.34
7 0.36
8 0.32
9 0.3
10 0.31
11 0.31
12 0.34
13 0.39
14 0.45
15 0.5
16 0.59
17 0.68
18 0.74
19 0.82
20 0.87
21 0.88
22 0.87
23 0.87
24 0.86
25 0.87
26 0.86
27 0.83
28 0.76
29 0.68
30 0.6
31 0.52
32 0.44
33 0.38
34 0.29
35 0.24
36 0.21
37 0.2
38 0.19
39 0.2
40 0.17
41 0.15
42 0.15
43 0.17
44 0.15
45 0.16
46 0.17
47 0.13
48 0.14
49 0.13
50 0.12
51 0.1
52 0.1
53 0.1
54 0.1
55 0.11
56 0.12
57 0.12
58 0.13
59 0.13
60 0.14
61 0.14
62 0.14
63 0.16
64 0.15
65 0.14
66 0.12
67 0.12
68 0.11
69 0.11
70 0.12
71 0.09
72 0.1
73 0.1
74 0.1
75 0.09
76 0.09
77 0.1
78 0.09
79 0.08
80 0.07
81 0.08
82 0.09
83 0.12
84 0.12
85 0.12
86 0.16
87 0.21
88 0.25
89 0.3
90 0.34
91 0.4
92 0.4
93 0.44
94 0.41
95 0.38
96 0.35
97 0.3
98 0.25
99 0.18
100 0.19
101 0.14
102 0.13
103 0.12
104 0.11
105 0.1
106 0.1
107 0.09
108 0.06
109 0.06
110 0.06
111 0.05
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04