Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PVE0

Protein Details
Accession F8PVE0    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
229-250SEGKWGKKGEKKKEEKGGRSQLBasic
278-300YISQFCPEKKKGKQPDQRIRMAEHydrophilic
NLS Segment(s)
PositionSequence
232-246KWGKKGEKKKEEKGG
Subcellular Location(s) cyto 15.5, cyto_nucl 11.5, nucl 6.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MSLDSTPENKQADSTKPEHVGYIVASDIYNKNKFEDFAAEGQPIPPPTPQILPTAPNSLPIPPTRTISNAAATKTTKFGQIDNSDGMPDQANEWMLSAKAYFDVNDTIYDSDRKKVFEALSHMKEGAALAWEETKLTEYIGSAKYPKWTDFETDFNGTFIIADVKGAASAALMTMKMETGGKAVKFNSCFMVEARKSGLNDGGLIMVYKRWMSTVSGLDANWTNSNSISEGKWGKKGEKKKEEKGGRSQLSSVKCLTKNKEDLLKRDGQCFICKEQGYISQFCPEKKKGKQPDQRIRMAEVAEKDETETVVEDGKGISHILKMWRELNEADQASAIDGLEKEGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.43
4 0.43
5 0.4
6 0.36
7 0.3
8 0.23
9 0.22
10 0.15
11 0.11
12 0.11
13 0.13
14 0.17
15 0.22
16 0.26
17 0.25
18 0.28
19 0.29
20 0.3
21 0.29
22 0.3
23 0.27
24 0.27
25 0.29
26 0.27
27 0.26
28 0.26
29 0.26
30 0.22
31 0.2
32 0.16
33 0.16
34 0.18
35 0.21
36 0.22
37 0.24
38 0.26
39 0.27
40 0.29
41 0.32
42 0.29
43 0.3
44 0.29
45 0.26
46 0.26
47 0.26
48 0.28
49 0.25
50 0.27
51 0.25
52 0.27
53 0.29
54 0.28
55 0.32
56 0.3
57 0.29
58 0.31
59 0.3
60 0.29
61 0.28
62 0.26
63 0.25
64 0.23
65 0.23
66 0.27
67 0.29
68 0.31
69 0.3
70 0.29
71 0.24
72 0.23
73 0.23
74 0.15
75 0.12
76 0.1
77 0.09
78 0.09
79 0.09
80 0.09
81 0.09
82 0.08
83 0.08
84 0.08
85 0.06
86 0.07
87 0.07
88 0.07
89 0.08
90 0.1
91 0.1
92 0.11
93 0.11
94 0.11
95 0.12
96 0.16
97 0.16
98 0.19
99 0.2
100 0.21
101 0.21
102 0.24
103 0.24
104 0.24
105 0.31
106 0.33
107 0.34
108 0.34
109 0.33
110 0.28
111 0.27
112 0.23
113 0.16
114 0.09
115 0.06
116 0.05
117 0.06
118 0.06
119 0.06
120 0.06
121 0.07
122 0.06
123 0.06
124 0.06
125 0.05
126 0.1
127 0.11
128 0.12
129 0.12
130 0.13
131 0.17
132 0.19
133 0.2
134 0.18
135 0.18
136 0.22
137 0.23
138 0.25
139 0.24
140 0.25
141 0.24
142 0.21
143 0.2
144 0.15
145 0.13
146 0.1
147 0.07
148 0.05
149 0.04
150 0.04
151 0.04
152 0.04
153 0.04
154 0.04
155 0.02
156 0.02
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.04
164 0.04
165 0.04
166 0.05
167 0.07
168 0.08
169 0.09
170 0.1
171 0.13
172 0.15
173 0.15
174 0.16
175 0.15
176 0.15
177 0.14
178 0.22
179 0.19
180 0.19
181 0.2
182 0.21
183 0.2
184 0.2
185 0.21
186 0.13
187 0.13
188 0.12
189 0.1
190 0.07
191 0.07
192 0.06
193 0.05
194 0.05
195 0.05
196 0.05
197 0.05
198 0.06
199 0.07
200 0.11
201 0.13
202 0.14
203 0.16
204 0.15
205 0.17
206 0.17
207 0.17
208 0.15
209 0.13
210 0.12
211 0.11
212 0.12
213 0.11
214 0.11
215 0.1
216 0.14
217 0.19
218 0.2
219 0.26
220 0.27
221 0.32
222 0.39
223 0.48
224 0.54
225 0.6
226 0.66
227 0.69
228 0.78
229 0.8
230 0.79
231 0.8
232 0.79
233 0.72
234 0.65
235 0.6
236 0.55
237 0.49
238 0.45
239 0.37
240 0.34
241 0.35
242 0.4
243 0.43
244 0.45
245 0.47
246 0.5
247 0.56
248 0.54
249 0.54
250 0.54
251 0.58
252 0.51
253 0.5
254 0.51
255 0.44
256 0.45
257 0.43
258 0.41
259 0.39
260 0.37
261 0.33
262 0.31
263 0.36
264 0.36
265 0.35
266 0.32
267 0.32
268 0.34
269 0.37
270 0.41
271 0.4
272 0.45
273 0.5
274 0.6
275 0.63
276 0.72
277 0.79
278 0.83
279 0.87
280 0.87
281 0.86
282 0.79
283 0.72
284 0.64
285 0.56
286 0.5
287 0.42
288 0.38
289 0.31
290 0.28
291 0.25
292 0.22
293 0.2
294 0.16
295 0.14
296 0.1
297 0.12
298 0.11
299 0.1
300 0.1
301 0.1
302 0.1
303 0.1
304 0.1
305 0.09
306 0.13
307 0.19
308 0.22
309 0.25
310 0.29
311 0.31
312 0.34
313 0.34
314 0.34
315 0.36
316 0.34
317 0.3
318 0.26
319 0.24
320 0.21
321 0.2
322 0.16
323 0.1
324 0.09