Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8QDZ9

Protein Details
Accession F8QDZ9    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-21SDVFDKKKLERLPKRREYDHBasic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR032567  LDOC1-rel  
Amino Acid Sequences YSDVFDKKKLERLPKRREYDHAINMKPEFVPTNCKLYPLAPKEDKALTEFLTDNYRKGYIRPSKSPQVSPFFFIGKKDGSLRPCQDYRKLNAYTVKDPYPLPLIPDLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.79
4 0.78
5 0.76
6 0.74
7 0.73
8 0.7
9 0.62
10 0.58
11 0.54
12 0.49
13 0.39
14 0.31
15 0.25
16 0.18
17 0.24
18 0.22
19 0.29
20 0.27
21 0.28
22 0.28
23 0.27
24 0.35
25 0.32
26 0.37
27 0.32
28 0.33
29 0.35
30 0.35
31 0.33
32 0.26
33 0.23
34 0.16
35 0.16
36 0.15
37 0.13
38 0.18
39 0.18
40 0.16
41 0.16
42 0.16
43 0.14
44 0.15
45 0.23
46 0.26
47 0.32
48 0.38
49 0.43
50 0.5
51 0.53
52 0.57
53 0.54
54 0.52
55 0.48
56 0.44
57 0.4
58 0.34
59 0.31
60 0.27
61 0.24
62 0.18
63 0.19
64 0.2
65 0.23
66 0.24
67 0.32
68 0.35
69 0.38
70 0.42
71 0.45
72 0.49
73 0.51
74 0.53
75 0.54
76 0.52
77 0.51
78 0.53
79 0.55
80 0.52
81 0.51
82 0.47
83 0.41
84 0.39
85 0.37
86 0.35
87 0.3
88 0.27