Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8QD33

Protein Details
Accession F8QD33    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-25ASQNTKKNPPADKQKKQLKTSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MEDASQNTKKNPPADKQKKQLKTSSTLSQNLDSKAIIDQILSTPIPLSIGNVIGLSKEVSQNLQEMMKPKRVNFGLDNKPQSLTAESLLAITHADLIRVPVTSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.73
3 0.77
4 0.82
5 0.84
6 0.82
7 0.8
8 0.73
9 0.69
10 0.65
11 0.63
12 0.59
13 0.55
14 0.51
15 0.49
16 0.47
17 0.41
18 0.37
19 0.28
20 0.22
21 0.18
22 0.17
23 0.12
24 0.08
25 0.08
26 0.07
27 0.09
28 0.09
29 0.08
30 0.07
31 0.07
32 0.08
33 0.07
34 0.07
35 0.05
36 0.06
37 0.06
38 0.06
39 0.06
40 0.05
41 0.05
42 0.05
43 0.05
44 0.06
45 0.06
46 0.07
47 0.07
48 0.08
49 0.09
50 0.09
51 0.1
52 0.14
53 0.17
54 0.24
55 0.25
56 0.25
57 0.32
58 0.32
59 0.35
60 0.35
61 0.42
62 0.43
63 0.5
64 0.53
65 0.46
66 0.46
67 0.42
68 0.39
69 0.32
70 0.24
71 0.17
72 0.15
73 0.14
74 0.13
75 0.12
76 0.11
77 0.08
78 0.07
79 0.1
80 0.09
81 0.09
82 0.09
83 0.12
84 0.12