Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8PXB2

Protein Details
Accession F8PXB2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGGTKRRVSVRRKTKERSHAAVAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
Amino Acid Sequences MGGTKRRVSVRRKTKERSHAAVATYLQTTDVYAPACATAAATADGETPDESVCKKVRGSTSERCIPRTRCTHGYGPTESVQIMLRMWPAGSYCKELPSEESCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.86
3 0.86
4 0.82
5 0.78
6 0.71
7 0.63
8 0.57
9 0.48
10 0.39
11 0.31
12 0.24
13 0.17
14 0.13
15 0.12
16 0.09
17 0.1
18 0.08
19 0.08
20 0.08
21 0.07
22 0.07
23 0.06
24 0.06
25 0.04
26 0.04
27 0.05
28 0.05
29 0.05
30 0.05
31 0.06
32 0.06
33 0.06
34 0.06
35 0.05
36 0.05
37 0.06
38 0.08
39 0.09
40 0.11
41 0.11
42 0.15
43 0.18
44 0.23
45 0.29
46 0.34
47 0.39
48 0.46
49 0.47
50 0.47
51 0.5
52 0.49
53 0.5
54 0.48
55 0.48
56 0.46
57 0.49
58 0.51
59 0.51
60 0.53
61 0.48
62 0.45
63 0.4
64 0.36
65 0.31
66 0.26
67 0.2
68 0.15
69 0.13
70 0.1
71 0.1
72 0.09
73 0.09
74 0.09
75 0.1
76 0.15
77 0.17
78 0.22
79 0.22
80 0.25
81 0.27
82 0.28
83 0.31