Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0V743

Protein Details
Accession Q0V743   
Localization Confidence High
Confidence Score 18.7
NoLS Segment(s)
PositionSequenceProtein Nature
201-228DSAASQPRPRKSKRGKKKSKSTETSDADHydrophilic
244-270DEAEPASTRPKRKQRGKKNKASADEAEHydrophilic
NLS Segment(s)
PositionSequence
207-220PRPRKSKRGKKKSK
252-264RPKRKQRGKKNKA
294-307AEAPKKRGRPRKSK
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011082  Exosome-assoc_fac/DNA_repair  
IPR007146  Sas10/Utp3/C1D  
Gene Ontology GO:0000178  C:exosome (RNase complex)  
GO:0005730  C:nucleolus  
GO:0003677  F:DNA binding  
GO:0003723  F:RNA binding  
GO:0000460  P:maturation of 5.8S rRNA  
GO:0010468  P:regulation of gene expression  
KEGG pno:SNOG_00171  -  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MDPQTDLPDLVEDLEVNIDELTTTLAPLLSTQLPTTASSLPLLDKAKLYVLAAYSIESLLYSTLQASGVNAKEHPIFKELARLKGYFGKIKHVEERPVVPKSKLDVSAAARFIKHGLAGNEKYDLERAERMAKERARAQLKARQINKKFDEEGREYIAPKKRGADEVVAEEDDGEMLTGLEDAPSKKPKLAEEADMEVDGDSAASQPRPRKSKRGKKKSKSTETSDADIESQEPSQEAAEAQDDEAEPASTRPKRKQRGKKNKASADEAEQETATPTRTTRSKKAGANTGGEEAEAPKKRGRPRKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.08
5 0.06
6 0.06
7 0.06
8 0.08
9 0.07
10 0.07
11 0.07
12 0.07
13 0.07
14 0.08
15 0.11
16 0.11
17 0.12
18 0.12
19 0.14
20 0.15
21 0.16
22 0.18
23 0.16
24 0.15
25 0.15
26 0.16
27 0.15
28 0.19
29 0.2
30 0.19
31 0.18
32 0.18
33 0.19
34 0.19
35 0.19
36 0.15
37 0.14
38 0.14
39 0.14
40 0.13
41 0.12
42 0.11
43 0.1
44 0.08
45 0.07
46 0.06
47 0.06
48 0.05
49 0.05
50 0.06
51 0.06
52 0.06
53 0.07
54 0.11
55 0.13
56 0.14
57 0.14
58 0.15
59 0.19
60 0.21
61 0.22
62 0.19
63 0.19
64 0.18
65 0.28
66 0.29
67 0.32
68 0.33
69 0.31
70 0.31
71 0.37
72 0.4
73 0.35
74 0.33
75 0.36
76 0.36
77 0.4
78 0.45
79 0.42
80 0.43
81 0.4
82 0.46
83 0.42
84 0.44
85 0.42
86 0.36
87 0.34
88 0.33
89 0.35
90 0.31
91 0.26
92 0.26
93 0.28
94 0.32
95 0.32
96 0.29
97 0.24
98 0.23
99 0.22
100 0.18
101 0.14
102 0.12
103 0.12
104 0.18
105 0.19
106 0.19
107 0.2
108 0.2
109 0.19
110 0.18
111 0.16
112 0.12
113 0.12
114 0.13
115 0.17
116 0.18
117 0.2
118 0.26
119 0.27
120 0.28
121 0.31
122 0.37
123 0.35
124 0.37
125 0.38
126 0.38
127 0.44
128 0.49
129 0.51
130 0.53
131 0.54
132 0.6
133 0.59
134 0.56
135 0.51
136 0.45
137 0.45
138 0.39
139 0.36
140 0.31
141 0.29
142 0.26
143 0.3
144 0.34
145 0.3
146 0.27
147 0.28
148 0.26
149 0.27
150 0.28
151 0.24
152 0.19
153 0.19
154 0.2
155 0.17
156 0.15
157 0.13
158 0.11
159 0.08
160 0.06
161 0.04
162 0.02
163 0.02
164 0.02
165 0.03
166 0.03
167 0.03
168 0.04
169 0.06
170 0.1
171 0.14
172 0.15
173 0.16
174 0.19
175 0.2
176 0.26
177 0.28
178 0.28
179 0.27
180 0.29
181 0.28
182 0.26
183 0.25
184 0.17
185 0.15
186 0.1
187 0.07
188 0.04
189 0.04
190 0.05
191 0.06
192 0.1
193 0.15
194 0.23
195 0.31
196 0.36
197 0.46
198 0.57
199 0.67
200 0.75
201 0.81
202 0.85
203 0.87
204 0.94
205 0.95
206 0.94
207 0.91
208 0.87
209 0.86
210 0.79
211 0.71
212 0.61
213 0.5
214 0.4
215 0.33
216 0.25
217 0.16
218 0.12
219 0.09
220 0.08
221 0.08
222 0.07
223 0.08
224 0.07
225 0.07
226 0.09
227 0.09
228 0.09
229 0.1
230 0.1
231 0.1
232 0.1
233 0.1
234 0.08
235 0.09
236 0.17
237 0.21
238 0.28
239 0.37
240 0.47
241 0.57
242 0.68
243 0.78
244 0.81
245 0.88
246 0.92
247 0.94
248 0.94
249 0.92
250 0.87
251 0.83
252 0.76
253 0.71
254 0.67
255 0.58
256 0.48
257 0.39
258 0.33
259 0.29
260 0.25
261 0.2
262 0.14
263 0.13
264 0.18
265 0.25
266 0.33
267 0.39
268 0.47
269 0.53
270 0.58
271 0.66
272 0.69
273 0.67
274 0.65
275 0.59
276 0.53
277 0.45
278 0.39
279 0.32
280 0.25
281 0.29
282 0.28
283 0.28
284 0.3
285 0.37
286 0.47
287 0.57