Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PPB2

Protein Details
Accession F8PPB2   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
74-113GVRSGPQRPKKIPRSPQQATPRPPRPYRSPYPRHGRIGRTHydrophilic
NLS Segment(s)
PositionSequence
76-109RSGPQRPKKIPRSPQQATPRPPRPYRSPYPRHGR
Subcellular Location(s) plas 6, extr 5, nucl 4, mito 4, mito_nucl 4, cyto 3, pero 3, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MNQHLLTITIDLLLSIPPHLSSFSPLKLDISSTITTLVQFLAFFAIIQYLQTELVSDIVYLHRVYIPTALRRVGVRSGPQRPKKIPRSPQQATPRPPRPYRSPYPRHGRIGRTDH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.07
4 0.07
5 0.07
6 0.09
7 0.09
8 0.13
9 0.16
10 0.18
11 0.19
12 0.19
13 0.2
14 0.19
15 0.2
16 0.17
17 0.18
18 0.16
19 0.14
20 0.15
21 0.14
22 0.14
23 0.13
24 0.11
25 0.07
26 0.06
27 0.06
28 0.05
29 0.05
30 0.05
31 0.04
32 0.05
33 0.04
34 0.05
35 0.05
36 0.04
37 0.04
38 0.04
39 0.05
40 0.04
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.07
52 0.11
53 0.13
54 0.14
55 0.17
56 0.17
57 0.17
58 0.17
59 0.19
60 0.18
61 0.19
62 0.23
63 0.28
64 0.37
65 0.46
66 0.53
67 0.59
68 0.63
69 0.7
70 0.74
71 0.77
72 0.77
73 0.78
74 0.8
75 0.77
76 0.79
77 0.8
78 0.79
79 0.77
80 0.77
81 0.76
82 0.75
83 0.77
84 0.74
85 0.73
86 0.72
87 0.75
88 0.76
89 0.75
90 0.76
91 0.81
92 0.82
93 0.82
94 0.8
95 0.76