Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PLC0

Protein Details
Accession F8PLC0    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
192-218GEKGHRSFKCKDAQKKKPQFNVREFLEHydrophilic
NLS Segment(s)
PositionSequence
136-161REKEKKGSDIGKKPYSEQKKEGEKKK
Subcellular Location(s) nucl 14, cyto 9, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005162  Retrotrans_gag_dom  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF03732  Retrotrans_gag  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MKEGEAAAFRTDWLENRVDAQQLGLDITNTYGSWPYFADKMEERFKDSFEKETAKNEILTLRQGNETAQAFFERFEEKKRWAGYTNRINEEFLISLLRRNMNKPLVDRVIYGGHIPRDYQEWKRELIRIDYIWREREKEKKGSDIGKKPYSEQKKEGEKKKDGTGYTYTGSGERMEVDKAKFRTEGRCYRCGEKGHRSFKCKDAQKKKPQFNVREFLEKMTKEEREKLLEGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.21
4 0.23
5 0.22
6 0.21
7 0.19
8 0.16
9 0.14
10 0.15
11 0.12
12 0.1
13 0.08
14 0.09
15 0.1
16 0.08
17 0.09
18 0.1
19 0.1
20 0.1
21 0.11
22 0.13
23 0.14
24 0.14
25 0.18
26 0.19
27 0.25
28 0.32
29 0.32
30 0.36
31 0.35
32 0.36
33 0.39
34 0.37
35 0.36
36 0.32
37 0.36
38 0.32
39 0.36
40 0.39
41 0.33
42 0.31
43 0.28
44 0.26
45 0.22
46 0.25
47 0.22
48 0.19
49 0.18
50 0.18
51 0.18
52 0.19
53 0.19
54 0.15
55 0.15
56 0.14
57 0.13
58 0.13
59 0.14
60 0.13
61 0.13
62 0.17
63 0.2
64 0.22
65 0.28
66 0.3
67 0.31
68 0.32
69 0.38
70 0.42
71 0.48
72 0.51
73 0.49
74 0.48
75 0.46
76 0.41
77 0.36
78 0.27
79 0.18
80 0.13
81 0.1
82 0.1
83 0.12
84 0.16
85 0.15
86 0.17
87 0.22
88 0.24
89 0.27
90 0.27
91 0.3
92 0.29
93 0.29
94 0.28
95 0.24
96 0.2
97 0.18
98 0.17
99 0.13
100 0.11
101 0.11
102 0.11
103 0.09
104 0.12
105 0.15
106 0.18
107 0.22
108 0.22
109 0.24
110 0.26
111 0.28
112 0.26
113 0.26
114 0.25
115 0.21
116 0.22
117 0.25
118 0.26
119 0.27
120 0.27
121 0.27
122 0.28
123 0.35
124 0.38
125 0.41
126 0.41
127 0.42
128 0.46
129 0.51
130 0.56
131 0.56
132 0.58
133 0.55
134 0.54
135 0.51
136 0.56
137 0.57
138 0.54
139 0.5
140 0.51
141 0.57
142 0.65
143 0.71
144 0.7
145 0.67
146 0.66
147 0.67
148 0.65
149 0.55
150 0.5
151 0.45
152 0.39
153 0.34
154 0.31
155 0.25
156 0.19
157 0.19
158 0.15
159 0.12
160 0.1
161 0.1
162 0.11
163 0.14
164 0.16
165 0.23
166 0.23
167 0.26
168 0.27
169 0.29
170 0.35
171 0.41
172 0.49
173 0.48
174 0.53
175 0.55
176 0.57
177 0.61
178 0.59
179 0.59
180 0.6
181 0.63
182 0.67
183 0.7
184 0.72
185 0.7
186 0.7
187 0.72
188 0.71
189 0.72
190 0.72
191 0.76
192 0.81
193 0.87
194 0.9
195 0.9
196 0.91
197 0.9
198 0.87
199 0.85
200 0.79
201 0.77
202 0.68
203 0.63
204 0.61
205 0.52
206 0.48
207 0.47
208 0.48
209 0.45
210 0.51
211 0.5
212 0.49