Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PHR2

Protein Details
Accession F8PHR2   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
27-56KSVQEWQKQKYQKRIKKKQHLKQEEEHKKQBasic
NLS Segment(s)
PositionSequence
38-58QKRIKKKQHLKQEEEHKKQKF
Subcellular Location(s) cyto 11.5cyto_nucl 11.5, nucl 10.5, mito 3
Family & Domain DBs
Amino Acid Sequences MKVNQAKFDDMKVMEEAFAAQAELEAKSVQEWQKQKYQKRIKKKQHLKQEEEHKKQKFEAKKQQVLRENLDGKWDNALAIQRFVAVWNFFNTSKVPPSAMKVPWPILSHPNVTTPHDTNWENVEAFITITGCLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.17
4 0.11
5 0.1
6 0.08
7 0.06
8 0.06
9 0.07
10 0.07
11 0.07
12 0.07
13 0.07
14 0.07
15 0.13
16 0.16
17 0.22
18 0.26
19 0.29
20 0.38
21 0.46
22 0.53
23 0.59
24 0.67
25 0.69
26 0.76
27 0.83
28 0.85
29 0.89
30 0.92
31 0.9
32 0.9
33 0.91
34 0.85
35 0.83
36 0.83
37 0.82
38 0.8
39 0.8
40 0.71
41 0.63
42 0.61
43 0.6
44 0.57
45 0.56
46 0.59
47 0.6
48 0.64
49 0.67
50 0.72
51 0.71
52 0.66
53 0.59
54 0.54
55 0.47
56 0.4
57 0.4
58 0.33
59 0.25
60 0.23
61 0.2
62 0.13
63 0.12
64 0.15
65 0.11
66 0.11
67 0.1
68 0.09
69 0.09
70 0.1
71 0.11
72 0.08
73 0.09
74 0.1
75 0.13
76 0.13
77 0.15
78 0.15
79 0.16
80 0.18
81 0.18
82 0.18
83 0.17
84 0.21
85 0.26
86 0.26
87 0.28
88 0.29
89 0.31
90 0.33
91 0.34
92 0.32
93 0.32
94 0.34
95 0.32
96 0.3
97 0.33
98 0.31
99 0.33
100 0.36
101 0.33
102 0.33
103 0.35
104 0.35
105 0.31
106 0.33
107 0.32
108 0.26
109 0.24
110 0.22
111 0.16
112 0.16
113 0.14
114 0.11