Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PFA5

Protein Details
Accession F8PFA5    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPSAPKPTRKRNRKRKRRASISSSSSSSHydrophilic
NLS Segment(s)
PositionSequence
6-20PKPTRKRNRKRKRRA
Subcellular Location(s) nucl 18.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR028217  Rsa3_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF14615  Rsa3  
Amino Acid Sequences MAPSAPKPTRKRNRKRKRRASISSSSSSSSGDASSDEETPKIAPAKKVPPPPEPSESASSSSDSDSDSDVEDTPDVQMAAVAPAETSKKAPPRRQSPSPPPSVVDLPSFLPSKPLGDDREKEVLLKERFRKFWMESLADGFRDDLEEIRKKEPNLGMSRLSLLIDSLASGADVFSSRSGNGDVNEMEVVLENLPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.96
3 0.96
4 0.97
5 0.96
6 0.95
7 0.93
8 0.91
9 0.87
10 0.81
11 0.72
12 0.63
13 0.52
14 0.43
15 0.34
16 0.25
17 0.18
18 0.12
19 0.11
20 0.11
21 0.12
22 0.13
23 0.13
24 0.12
25 0.12
26 0.12
27 0.15
28 0.18
29 0.19
30 0.21
31 0.27
32 0.36
33 0.42
34 0.5
35 0.52
36 0.55
37 0.58
38 0.6
39 0.58
40 0.54
41 0.51
42 0.47
43 0.43
44 0.39
45 0.33
46 0.29
47 0.25
48 0.22
49 0.18
50 0.14
51 0.12
52 0.1
53 0.1
54 0.09
55 0.09
56 0.09
57 0.09
58 0.09
59 0.08
60 0.07
61 0.07
62 0.06
63 0.05
64 0.05
65 0.04
66 0.04
67 0.04
68 0.04
69 0.03
70 0.04
71 0.05
72 0.06
73 0.07
74 0.1
75 0.18
76 0.26
77 0.33
78 0.4
79 0.49
80 0.56
81 0.62
82 0.68
83 0.7
84 0.7
85 0.68
86 0.61
87 0.52
88 0.47
89 0.41
90 0.34
91 0.24
92 0.18
93 0.14
94 0.16
95 0.15
96 0.13
97 0.13
98 0.12
99 0.12
100 0.13
101 0.15
102 0.17
103 0.21
104 0.22
105 0.25
106 0.29
107 0.28
108 0.27
109 0.26
110 0.31
111 0.29
112 0.35
113 0.38
114 0.4
115 0.41
116 0.43
117 0.46
118 0.39
119 0.42
120 0.41
121 0.36
122 0.31
123 0.34
124 0.33
125 0.28
126 0.26
127 0.2
128 0.14
129 0.13
130 0.12
131 0.1
132 0.14
133 0.2
134 0.23
135 0.27
136 0.31
137 0.3
138 0.37
139 0.39
140 0.41
141 0.41
142 0.42
143 0.39
144 0.36
145 0.38
146 0.32
147 0.28
148 0.19
149 0.14
150 0.11
151 0.08
152 0.07
153 0.06
154 0.05
155 0.05
156 0.05
157 0.04
158 0.04
159 0.05
160 0.06
161 0.07
162 0.08
163 0.08
164 0.1
165 0.12
166 0.14
167 0.14
168 0.17
169 0.16
170 0.17
171 0.17
172 0.15
173 0.14
174 0.12
175 0.12