Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PYR7

Protein Details
Accession F8PYR7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
62-82AKTGCRPPNKKNNQGRQARQLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, extr 7, cyto_mito 7
Family & Domain DBs
Amino Acid Sequences MYPRGALGHQTTIITLTGSNCLGCNQGREPLWISAWSRADRYADSKGTATIAAKRDTCPKIAKTGCRPPNKKNNQGRQARQLETEKPDNQLQTLAGRSYDEIRAFFYNQQVAEIKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.12
3 0.1
4 0.11
5 0.11
6 0.11
7 0.1
8 0.11
9 0.13
10 0.13
11 0.16
12 0.15
13 0.2
14 0.21
15 0.23
16 0.26
17 0.25
18 0.25
19 0.24
20 0.24
21 0.24
22 0.27
23 0.25
24 0.23
25 0.23
26 0.23
27 0.22
28 0.24
29 0.23
30 0.21
31 0.21
32 0.2
33 0.19
34 0.18
35 0.17
36 0.14
37 0.14
38 0.16
39 0.17
40 0.17
41 0.18
42 0.25
43 0.25
44 0.28
45 0.27
46 0.25
47 0.31
48 0.34
49 0.39
50 0.39
51 0.48
52 0.54
53 0.6
54 0.64
55 0.64
56 0.71
57 0.74
58 0.77
59 0.77
60 0.79
61 0.79
62 0.83
63 0.8
64 0.79
65 0.77
66 0.68
67 0.63
68 0.57
69 0.52
70 0.49
71 0.5
72 0.42
73 0.39
74 0.41
75 0.36
76 0.32
77 0.29
78 0.24
79 0.2
80 0.2
81 0.17
82 0.15
83 0.15
84 0.15
85 0.17
86 0.2
87 0.19
88 0.18
89 0.2
90 0.23
91 0.25
92 0.26
93 0.28
94 0.27
95 0.26
96 0.29