Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8Q3W9

Protein Details
Accession F8Q3W9   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
40-59QKSTPRRWCHPRNYSCRYSRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito_nucl 12.666, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences MERRCPNILPDSFWRRKLHSTIHRILLERWGRKIYWQCIQKSTPRRWCHPRNYSCRYSRTKWHCRMHESDIGYISNHYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.51
3 0.55
4 0.55
5 0.56
6 0.56
7 0.59
8 0.59
9 0.62
10 0.61
11 0.56
12 0.51
13 0.5
14 0.47
15 0.41
16 0.38
17 0.32
18 0.3
19 0.33
20 0.4
21 0.35
22 0.35
23 0.39
24 0.38
25 0.41
26 0.43
27 0.46
28 0.47
29 0.52
30 0.54
31 0.52
32 0.58
33 0.63
34 0.7
35 0.73
36 0.75
37 0.76
38 0.76
39 0.79
40 0.8
41 0.76
42 0.76
43 0.72
44 0.66
45 0.67
46 0.68
47 0.71
48 0.73
49 0.76
50 0.76
51 0.75
52 0.77
53 0.74
54 0.71
55 0.63
56 0.56
57 0.48
58 0.42
59 0.35