Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PKW9

Protein Details
Accession F8PKW9    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
314-333HDTIRKKSREYRIRDALQKVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12, nucl 11.5, cyto 9.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002088  Prenyl_trans_a  
Gene Ontology GO:0008318  F:protein prenyltransferase activity  
GO:0018342  P:protein prenylation  
Pfam View protein in Pfam  
PF01239  PPTA  
PROSITE View protein in PROSITE  
PS51147  PFTA  
Amino Acid Sequences MTSEPDAPLFADRPEWEDVVPLPQYENVDPLAPIFYTDEYKDATNYFRGIVKTGEMSPRVLELTENIIRQNPAHYSAWQYRYKTLMALKAPLDVELRLMDELAVRYLKTYQVWHHRRLLVTETREPGPELEFITKSLQEDMKNYHTWSYRQWLLAYFNDDALWSDELNFADQMLESDIRNNSAWHHRFFVVFQSGVRTGDENREEVVRRELAFVKNYISLAPNNASAWNYLRGILDHSATPYSQLLLFVTPYSVPRSPDADLVDVIDLENPPPSMGAQLPCVAAIEFLADIHENEGGDDIMKATELWRSLADEHDTIRKKSREYRIRDALQKVQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.2
4 0.21
5 0.21
6 0.22
7 0.22
8 0.18
9 0.17
10 0.18
11 0.21
12 0.2
13 0.21
14 0.17
15 0.17
16 0.17
17 0.16
18 0.15
19 0.12
20 0.12
21 0.12
22 0.12
23 0.14
24 0.15
25 0.16
26 0.16
27 0.17
28 0.17
29 0.17
30 0.18
31 0.18
32 0.18
33 0.18
34 0.2
35 0.2
36 0.21
37 0.2
38 0.19
39 0.2
40 0.22
41 0.26
42 0.23
43 0.23
44 0.22
45 0.22
46 0.21
47 0.18
48 0.15
49 0.11
50 0.17
51 0.19
52 0.19
53 0.19
54 0.2
55 0.21
56 0.21
57 0.23
58 0.18
59 0.19
60 0.21
61 0.21
62 0.26
63 0.33
64 0.4
65 0.42
66 0.42
67 0.4
68 0.41
69 0.4
70 0.37
71 0.33
72 0.32
73 0.29
74 0.3
75 0.28
76 0.28
77 0.28
78 0.25
79 0.23
80 0.16
81 0.15
82 0.12
83 0.13
84 0.09
85 0.09
86 0.08
87 0.08
88 0.08
89 0.09
90 0.09
91 0.08
92 0.08
93 0.09
94 0.11
95 0.11
96 0.14
97 0.19
98 0.3
99 0.35
100 0.39
101 0.45
102 0.47
103 0.46
104 0.45
105 0.45
106 0.41
107 0.4
108 0.4
109 0.36
110 0.34
111 0.34
112 0.32
113 0.27
114 0.21
115 0.17
116 0.14
117 0.14
118 0.13
119 0.14
120 0.15
121 0.15
122 0.14
123 0.15
124 0.16
125 0.14
126 0.16
127 0.19
128 0.21
129 0.22
130 0.22
131 0.24
132 0.23
133 0.24
134 0.24
135 0.26
136 0.24
137 0.24
138 0.24
139 0.22
140 0.23
141 0.23
142 0.24
143 0.19
144 0.16
145 0.15
146 0.14
147 0.13
148 0.12
149 0.11
150 0.07
151 0.07
152 0.09
153 0.09
154 0.1
155 0.09
156 0.07
157 0.06
158 0.06
159 0.06
160 0.06
161 0.06
162 0.06
163 0.08
164 0.08
165 0.1
166 0.1
167 0.1
168 0.11
169 0.2
170 0.23
171 0.22
172 0.25
173 0.24
174 0.24
175 0.25
176 0.27
177 0.2
178 0.18
179 0.16
180 0.17
181 0.17
182 0.17
183 0.17
184 0.13
185 0.11
186 0.17
187 0.18
188 0.15
189 0.15
190 0.17
191 0.18
192 0.18
193 0.21
194 0.17
195 0.16
196 0.18
197 0.21
198 0.22
199 0.22
200 0.22
201 0.2
202 0.19
203 0.19
204 0.17
205 0.15
206 0.13
207 0.14
208 0.14
209 0.13
210 0.13
211 0.13
212 0.13
213 0.13
214 0.15
215 0.15
216 0.14
217 0.14
218 0.14
219 0.13
220 0.16
221 0.16
222 0.15
223 0.12
224 0.13
225 0.13
226 0.13
227 0.14
228 0.11
229 0.1
230 0.1
231 0.1
232 0.09
233 0.09
234 0.1
235 0.08
236 0.09
237 0.08
238 0.09
239 0.14
240 0.16
241 0.17
242 0.19
243 0.22
244 0.22
245 0.25
246 0.26
247 0.23
248 0.21
249 0.2
250 0.18
251 0.14
252 0.13
253 0.11
254 0.09
255 0.08
256 0.09
257 0.08
258 0.07
259 0.08
260 0.08
261 0.09
262 0.11
263 0.13
264 0.14
265 0.15
266 0.15
267 0.15
268 0.16
269 0.13
270 0.1
271 0.09
272 0.08
273 0.06
274 0.06
275 0.07
276 0.07
277 0.07
278 0.08
279 0.09
280 0.08
281 0.08
282 0.09
283 0.08
284 0.08
285 0.08
286 0.07
287 0.06
288 0.06
289 0.06
290 0.06
291 0.1
292 0.1
293 0.12
294 0.12
295 0.15
296 0.16
297 0.2
298 0.24
299 0.22
300 0.24
301 0.32
302 0.35
303 0.36
304 0.44
305 0.44
306 0.46
307 0.54
308 0.63
309 0.63
310 0.67
311 0.75
312 0.76
313 0.8
314 0.82
315 0.79