Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PJD1

Protein Details
Accession F8PJD1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
76-107ERVMPKGPIFPRRRRRRPRRPPGEGARPSRLTBasic
NLS Segment(s)
PositionSequence
82-104GPIFPRRRRRRPRRPPGEGARPS
Subcellular Location(s) nucl 10cyto 10cyto_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR011993  PH-like_dom_sf  
Amino Acid Sequences MRNGEVPKPGRSDLIRAYTLQHAESGLGNDYLKRKNVIRVRMEGEQFLLQAHDVPAVVEWIEGLHAGVNISLDLDERVMPKGPIFPRRRRRRPRRPPGEGARPSRLTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.34
4 0.35
5 0.35
6 0.34
7 0.29
8 0.23
9 0.17
10 0.16
11 0.16
12 0.15
13 0.11
14 0.11
15 0.1
16 0.12
17 0.16
18 0.18
19 0.19
20 0.2
21 0.21
22 0.29
23 0.35
24 0.41
25 0.41
26 0.43
27 0.46
28 0.48
29 0.47
30 0.38
31 0.33
32 0.25
33 0.21
34 0.16
35 0.12
36 0.07
37 0.07
38 0.07
39 0.05
40 0.05
41 0.04
42 0.04
43 0.04
44 0.04
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.05
62 0.06
63 0.06
64 0.08
65 0.09
66 0.1
67 0.1
68 0.17
69 0.22
70 0.31
71 0.38
72 0.47
73 0.57
74 0.68
75 0.79
76 0.83
77 0.9
78 0.91
79 0.95
80 0.96
81 0.96
82 0.94
83 0.93
84 0.92
85 0.92
86 0.9
87 0.85
88 0.83