Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PY54

Protein Details
Accession F8PY54   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
72-99PYSRTLRHYKEQKERRKHQLNRSRPEFTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MTTSPLETSPSFAISLKRSSSFAEPLPHKLPRMTLSRTVSYLSLADCHIENQSELQLSSPSSFTPNAPSRVPYSRTLRHYKEQKERRKHQLNRSRPEFTITPAPSPSPPKASPPTPKASPTPMHCPRASSPLAPNRKPLPPRASFPRSKQEPDLYRVAIKTRMRCSQEGEKILLMGPRMALSILSATKELEKIVASQMDVDRDLSMAKDDWEMLGISV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.27
4 0.27
5 0.27
6 0.29
7 0.32
8 0.32
9 0.32
10 0.36
11 0.36
12 0.41
13 0.45
14 0.45
15 0.42
16 0.39
17 0.39
18 0.36
19 0.4
20 0.38
21 0.41
22 0.43
23 0.44
24 0.43
25 0.41
26 0.36
27 0.3
28 0.26
29 0.18
30 0.14
31 0.12
32 0.12
33 0.1
34 0.11
35 0.11
36 0.11
37 0.1
38 0.1
39 0.11
40 0.11
41 0.11
42 0.11
43 0.1
44 0.1
45 0.11
46 0.11
47 0.09
48 0.11
49 0.12
50 0.12
51 0.19
52 0.23
53 0.25
54 0.26
55 0.27
56 0.29
57 0.34
58 0.37
59 0.35
60 0.37
61 0.41
62 0.47
63 0.53
64 0.54
65 0.57
66 0.62
67 0.65
68 0.69
69 0.72
70 0.76
71 0.78
72 0.81
73 0.83
74 0.85
75 0.85
76 0.85
77 0.85
78 0.85
79 0.84
80 0.82
81 0.75
82 0.64
83 0.6
84 0.49
85 0.41
86 0.4
87 0.32
88 0.27
89 0.24
90 0.25
91 0.22
92 0.26
93 0.24
94 0.21
95 0.21
96 0.24
97 0.28
98 0.32
99 0.37
100 0.38
101 0.43
102 0.39
103 0.41
104 0.38
105 0.39
106 0.38
107 0.35
108 0.4
109 0.41
110 0.44
111 0.41
112 0.43
113 0.39
114 0.41
115 0.38
116 0.3
117 0.3
118 0.35
119 0.42
120 0.4
121 0.43
122 0.41
123 0.46
124 0.47
125 0.48
126 0.47
127 0.43
128 0.47
129 0.52
130 0.55
131 0.55
132 0.58
133 0.61
134 0.58
135 0.57
136 0.57
137 0.56
138 0.54
139 0.52
140 0.51
141 0.43
142 0.4
143 0.37
144 0.34
145 0.33
146 0.33
147 0.35
148 0.37
149 0.43
150 0.45
151 0.45
152 0.5
153 0.52
154 0.56
155 0.52
156 0.48
157 0.41
158 0.37
159 0.37
160 0.31
161 0.22
162 0.14
163 0.12
164 0.09
165 0.1
166 0.09
167 0.07
168 0.07
169 0.09
170 0.1
171 0.1
172 0.11
173 0.11
174 0.13
175 0.13
176 0.13
177 0.11
178 0.11
179 0.11
180 0.15
181 0.16
182 0.14
183 0.18
184 0.19
185 0.21
186 0.21
187 0.2
188 0.16
189 0.15
190 0.15
191 0.12
192 0.13
193 0.11
194 0.11
195 0.12
196 0.12
197 0.12
198 0.13