Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PNR5

Protein Details
Accession F8PNR5    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
159-193NEPPPPAKKGKKGGEPYKGKINRVKKDGKGKGKAPBasic
NLS Segment(s)
PositionSequence
139-195KRAAKRRRELTDRSEGASRSNEPPPPAKKGKKGGEPYKGKINRVKKDGKGKGKAPQK
Subcellular Location(s) cyto 12.5, cyto_nucl 9.333, mito_nucl 5.833, mito 5.5, nucl 5
Family & Domain DBs
Amino Acid Sequences MLVHIPAGLEDARSARLLSVQQCLTIGEIVVLVPMPYTNATHEFLELVFSSHEKELAADVAHKKLQALRDAGNFPSSLAEVKVQNKWSLKADTNVAMGEVTASGSKSVESLIDRKVSMALKKILPFLTLLQKNKVDFVKRAAKRRRELTDRSEGASRSNEPPPPAKKGKKGGEPYKGKINRVKKDGKGKGKAPQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.13
4 0.17
5 0.19
6 0.24
7 0.23
8 0.22
9 0.22
10 0.22
11 0.2
12 0.17
13 0.14
14 0.08
15 0.07
16 0.06
17 0.06
18 0.06
19 0.04
20 0.04
21 0.04
22 0.05
23 0.06
24 0.07
25 0.09
26 0.13
27 0.15
28 0.15
29 0.16
30 0.15
31 0.14
32 0.15
33 0.13
34 0.1
35 0.09
36 0.09
37 0.11
38 0.1
39 0.11
40 0.09
41 0.09
42 0.09
43 0.09
44 0.1
45 0.11
46 0.13
47 0.16
48 0.16
49 0.16
50 0.16
51 0.18
52 0.21
53 0.21
54 0.22
55 0.21
56 0.25
57 0.27
58 0.26
59 0.25
60 0.21
61 0.17
62 0.15
63 0.12
64 0.09
65 0.08
66 0.09
67 0.11
68 0.13
69 0.17
70 0.18
71 0.21
72 0.22
73 0.23
74 0.25
75 0.25
76 0.24
77 0.23
78 0.23
79 0.21
80 0.2
81 0.18
82 0.14
83 0.11
84 0.09
85 0.07
86 0.05
87 0.04
88 0.03
89 0.03
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.05
96 0.06
97 0.08
98 0.1
99 0.12
100 0.12
101 0.12
102 0.15
103 0.16
104 0.17
105 0.19
106 0.2
107 0.21
108 0.23
109 0.25
110 0.23
111 0.21
112 0.2
113 0.19
114 0.25
115 0.28
116 0.28
117 0.3
118 0.32
119 0.32
120 0.35
121 0.37
122 0.31
123 0.27
124 0.32
125 0.38
126 0.41
127 0.51
128 0.57
129 0.62
130 0.66
131 0.72
132 0.74
133 0.71
134 0.72
135 0.7
136 0.71
137 0.63
138 0.59
139 0.54
140 0.45
141 0.41
142 0.38
143 0.34
144 0.28
145 0.31
146 0.31
147 0.31
148 0.39
149 0.4
150 0.46
151 0.52
152 0.55
153 0.59
154 0.66
155 0.72
156 0.73
157 0.79
158 0.8
159 0.8
160 0.81
161 0.76
162 0.77
163 0.74
164 0.7
165 0.69
166 0.69
167 0.68
168 0.69
169 0.74
170 0.71
171 0.77
172 0.82
173 0.83
174 0.81
175 0.78