Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PFS6

Protein Details
Accession F8PFS6    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
9-48LHANHFRKDWQRRVRTWFEQPGRKLRRRNARKTKAVTLGVHydrophilic
187-213RYDGARKVRAAKRRRGSKQKEIGYCFLHydrophilic
NLS Segment(s)
PositionSequence
29-42PGRKLRRRNARKTK
183-205RASARYDGARKVRAAKRRRGSKQ
Subcellular Location(s) mito 18, cyto 6, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001380  Ribosomal_L13e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01294  Ribosomal_L13e  
Amino Acid Sequences MGFAHNNVLHANHFRKDWQRRVRTWFEQPGRKLRRRNARKTKAVTLGVRPLTLLRPAVHCQTVRYNRKIRLGRGFTYAELREAGINRREARGIGIVVDHRRRNLSEDGKEMNVKRLAAYKEKLVVFPRKTSKPKKGDSTGDDIQVVSTQFNTRLVNPYTLDAPRAITEEERLFRAYRSLRGARASARYDGARKVRAAKRRRGSKQKEIGYCFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.42
3 0.5
4 0.58
5 0.61
6 0.66
7 0.7
8 0.78
9 0.81
10 0.78
11 0.78
12 0.78
13 0.76
14 0.76
15 0.75
16 0.77
17 0.78
18 0.78
19 0.77
20 0.76
21 0.78
22 0.8
23 0.85
24 0.86
25 0.86
26 0.88
27 0.87
28 0.86
29 0.83
30 0.79
31 0.71
32 0.65
33 0.63
34 0.54
35 0.47
36 0.39
37 0.31
38 0.26
39 0.25
40 0.22
41 0.15
42 0.18
43 0.21
44 0.24
45 0.26
46 0.25
47 0.25
48 0.33
49 0.42
50 0.45
51 0.5
52 0.54
53 0.56
54 0.65
55 0.67
56 0.63
57 0.63
58 0.61
59 0.55
60 0.53
61 0.49
62 0.4
63 0.4
64 0.34
65 0.25
66 0.2
67 0.18
68 0.14
69 0.14
70 0.17
71 0.16
72 0.2
73 0.2
74 0.2
75 0.2
76 0.19
77 0.19
78 0.17
79 0.14
80 0.1
81 0.1
82 0.11
83 0.15
84 0.2
85 0.19
86 0.18
87 0.19
88 0.2
89 0.23
90 0.28
91 0.3
92 0.27
93 0.3
94 0.31
95 0.31
96 0.33
97 0.29
98 0.27
99 0.22
100 0.2
101 0.17
102 0.21
103 0.22
104 0.24
105 0.25
106 0.22
107 0.26
108 0.26
109 0.28
110 0.27
111 0.32
112 0.3
113 0.35
114 0.4
115 0.42
116 0.51
117 0.57
118 0.63
119 0.64
120 0.68
121 0.7
122 0.7
123 0.69
124 0.64
125 0.64
126 0.56
127 0.48
128 0.42
129 0.33
130 0.27
131 0.21
132 0.18
133 0.1
134 0.09
135 0.08
136 0.09
137 0.12
138 0.13
139 0.13
140 0.19
141 0.21
142 0.22
143 0.22
144 0.23
145 0.24
146 0.23
147 0.23
148 0.17
149 0.16
150 0.14
151 0.15
152 0.15
153 0.12
154 0.16
155 0.19
156 0.2
157 0.21
158 0.22
159 0.21
160 0.2
161 0.27
162 0.26
163 0.26
164 0.33
165 0.35
166 0.36
167 0.39
168 0.42
169 0.4
170 0.43
171 0.41
172 0.36
173 0.36
174 0.36
175 0.35
176 0.4
177 0.42
178 0.4
179 0.39
180 0.46
181 0.5
182 0.56
183 0.62
184 0.65
185 0.69
186 0.76
187 0.84
188 0.85
189 0.87
190 0.89
191 0.9
192 0.89
193 0.88