Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PV62

Protein Details
Accession F8PV62    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
53-78GGSTRGRGSKRGKKGDKTKNNTFGAPHydrophilic
NLS Segment(s)
PositionSequence
36-70KPKPTKSTSRTRTASGRGGSTRGRGSKRGKKGDKT
Subcellular Location(s) mito 23.5, cyto_mito 13.5
Family & Domain DBs
Amino Acid Sequences MGSAWALQHRYVFSFYMKFLISQFSPACPNGASSAKPKPTKSTSRTRTASGRGGSTRGRGSKRGKKGDKTKNNTFGAPDDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.2
4 0.19
5 0.17
6 0.16
7 0.19
8 0.16
9 0.18
10 0.18
11 0.17
12 0.19
13 0.19
14 0.19
15 0.15
16 0.16
17 0.15
18 0.16
19 0.16
20 0.17
21 0.23
22 0.29
23 0.33
24 0.33
25 0.36
26 0.4
27 0.47
28 0.49
29 0.53
30 0.52
31 0.57
32 0.59
33 0.56
34 0.54
35 0.5
36 0.51
37 0.42
38 0.4
39 0.32
40 0.33
41 0.31
42 0.3
43 0.3
44 0.31
45 0.32
46 0.36
47 0.45
48 0.51
49 0.6
50 0.68
51 0.71
52 0.75
53 0.82
54 0.86
55 0.87
56 0.86
57 0.87
58 0.85
59 0.8
60 0.72
61 0.64