Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8Q094

Protein Details
Accession F8Q094   
Localization Confidence High
Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPHKRAKRSVREREKVNKGVDBasic
60-83DGDAGKPQRKKSKKEVNPKEYQNDHydrophilic
NLS Segment(s)
PositionSequence
5-11RAKRSVR
51-73RERKRKVVEDGDAGKPQRKKSKK
Subcellular Location(s) nucl 18, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MPHKRAKRSVREREKVNKGVDLPPPTSLVTEKVPKTASRILNAEKIRQEYRERKRKVVEDGDAGKPQRKKSKKEVNPKEYQNDEPVLKIKTGETIAQFNKRVEKTMLPAIRSAIHSSSSQAKNVNQAQAEEKVVRKDNSTSARHPTRGHKEEAMTLGPSLLQKTPRNASENIKEFQSTSTSAPRRLNDIAQAPPEFKKLPRGVSGDAGMNIKGKSQGVLSMAQKLMMEEEREKAILRYREMKANKAKLDGSVRERGDM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.85
3 0.77
4 0.72
5 0.64
6 0.62
7 0.6
8 0.55
9 0.47
10 0.4
11 0.39
12 0.34
13 0.32
14 0.26
15 0.22
16 0.22
17 0.28
18 0.28
19 0.3
20 0.32
21 0.31
22 0.36
23 0.41
24 0.4
25 0.37
26 0.41
27 0.41
28 0.47
29 0.49
30 0.48
31 0.44
32 0.45
33 0.43
34 0.42
35 0.47
36 0.49
37 0.58
38 0.63
39 0.63
40 0.65
41 0.7
42 0.72
43 0.72
44 0.69
45 0.63
46 0.6
47 0.6
48 0.57
49 0.54
50 0.49
51 0.46
52 0.42
53 0.44
54 0.47
55 0.5
56 0.53
57 0.59
58 0.69
59 0.73
60 0.81
61 0.85
62 0.84
63 0.85
64 0.83
65 0.79
66 0.71
67 0.64
68 0.56
69 0.49
70 0.4
71 0.33
72 0.3
73 0.24
74 0.21
75 0.19
76 0.15
77 0.14
78 0.15
79 0.16
80 0.14
81 0.19
82 0.22
83 0.27
84 0.28
85 0.27
86 0.32
87 0.3
88 0.31
89 0.28
90 0.27
91 0.25
92 0.31
93 0.32
94 0.26
95 0.26
96 0.25
97 0.24
98 0.24
99 0.22
100 0.14
101 0.13
102 0.13
103 0.14
104 0.21
105 0.2
106 0.21
107 0.21
108 0.21
109 0.26
110 0.28
111 0.3
112 0.22
113 0.22
114 0.22
115 0.21
116 0.22
117 0.17
118 0.16
119 0.16
120 0.19
121 0.18
122 0.18
123 0.18
124 0.23
125 0.29
126 0.31
127 0.31
128 0.36
129 0.39
130 0.41
131 0.42
132 0.45
133 0.47
134 0.47
135 0.47
136 0.42
137 0.39
138 0.39
139 0.38
140 0.3
141 0.21
142 0.17
143 0.14
144 0.12
145 0.11
146 0.1
147 0.1
148 0.14
149 0.16
150 0.21
151 0.25
152 0.28
153 0.32
154 0.33
155 0.37
156 0.4
157 0.42
158 0.39
159 0.36
160 0.33
161 0.29
162 0.27
163 0.24
164 0.18
165 0.15
166 0.23
167 0.25
168 0.3
169 0.34
170 0.34
171 0.36
172 0.37
173 0.36
174 0.32
175 0.33
176 0.31
177 0.31
178 0.31
179 0.28
180 0.27
181 0.28
182 0.25
183 0.22
184 0.28
185 0.29
186 0.32
187 0.36
188 0.39
189 0.38
190 0.39
191 0.4
192 0.32
193 0.3
194 0.27
195 0.21
196 0.19
197 0.17
198 0.15
199 0.15
200 0.13
201 0.12
202 0.12
203 0.14
204 0.14
205 0.2
206 0.2
207 0.24
208 0.24
209 0.24
210 0.23
211 0.2
212 0.22
213 0.19
214 0.21
215 0.17
216 0.19
217 0.21
218 0.21
219 0.22
220 0.21
221 0.26
222 0.28
223 0.31
224 0.37
225 0.38
226 0.47
227 0.5
228 0.57
229 0.59
230 0.62
231 0.61
232 0.57
233 0.55
234 0.53
235 0.58
236 0.56
237 0.52
238 0.52