Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9XRZ5

Protein Details
Accession F9XRZ5   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
178-202AIVNSLMKARRRRNKAEKHGGDEHDHydrophilic
NLS Segment(s)
PositionSequence
186-194ARRRRNKAE
Subcellular Location(s) nucl 17, cyto_nucl 14, cyto 7
Family & Domain DBs
KEGG ztr:MYCGRDRAFT_97985  -  
Amino Acid Sequences MDPFHAACGIWTDFELPLHRQLCDDLPALWKQPATSGELDAGCVRNLEYGGGGSEGAPGRELKSLKKTSPPLATSDTVQRHLSRYRAPLREEDEQPVRNRSTSRLSRAEATPTRAPQYLESERRRTTTTTTARDIERRHTGRSRHHELERLATSAQDPGSEGKSGASKQRYRGQHDSAIVNSLMKARRRRNKAEKHGGDEHDGETKDEACRDSHRRVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.17
4 0.24
5 0.25
6 0.25
7 0.24
8 0.25
9 0.26
10 0.26
11 0.25
12 0.18
13 0.21
14 0.23
15 0.24
16 0.24
17 0.21
18 0.18
19 0.21
20 0.21
21 0.22
22 0.21
23 0.2
24 0.21
25 0.21
26 0.22
27 0.19
28 0.19
29 0.14
30 0.13
31 0.12
32 0.1
33 0.1
34 0.09
35 0.08
36 0.07
37 0.07
38 0.07
39 0.07
40 0.06
41 0.09
42 0.09
43 0.09
44 0.1
45 0.09
46 0.1
47 0.15
48 0.16
49 0.17
50 0.26
51 0.3
52 0.32
53 0.39
54 0.42
55 0.44
56 0.51
57 0.48
58 0.42
59 0.42
60 0.41
61 0.35
62 0.38
63 0.34
64 0.3
65 0.3
66 0.27
67 0.26
68 0.28
69 0.29
70 0.26
71 0.31
72 0.37
73 0.4
74 0.41
75 0.42
76 0.44
77 0.47
78 0.44
79 0.41
80 0.38
81 0.37
82 0.37
83 0.36
84 0.31
85 0.27
86 0.26
87 0.24
88 0.28
89 0.29
90 0.34
91 0.34
92 0.34
93 0.36
94 0.36
95 0.4
96 0.33
97 0.34
98 0.3
99 0.27
100 0.29
101 0.27
102 0.27
103 0.21
104 0.27
105 0.29
106 0.34
107 0.38
108 0.41
109 0.41
110 0.42
111 0.42
112 0.36
113 0.33
114 0.34
115 0.37
116 0.36
117 0.38
118 0.39
119 0.39
120 0.42
121 0.4
122 0.36
123 0.38
124 0.36
125 0.38
126 0.41
127 0.45
128 0.51
129 0.58
130 0.61
131 0.57
132 0.58
133 0.59
134 0.54
135 0.56
136 0.47
137 0.4
138 0.32
139 0.26
140 0.23
141 0.2
142 0.18
143 0.11
144 0.1
145 0.1
146 0.12
147 0.12
148 0.12
149 0.11
150 0.14
151 0.15
152 0.21
153 0.28
154 0.3
155 0.35
156 0.44
157 0.49
158 0.55
159 0.61
160 0.59
161 0.57
162 0.57
163 0.55
164 0.47
165 0.43
166 0.35
167 0.28
168 0.23
169 0.22
170 0.23
171 0.27
172 0.35
173 0.43
174 0.52
175 0.61
176 0.71
177 0.77
178 0.83
179 0.87
180 0.89
181 0.86
182 0.84
183 0.84
184 0.76
185 0.7
186 0.61
187 0.51
188 0.46
189 0.39
190 0.33
191 0.26
192 0.25
193 0.22
194 0.23
195 0.22
196 0.18
197 0.26
198 0.31