Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F9XA45

Protein Details
Accession F9XA45    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
395-417EDEDSKSVKVEKKVRRPKRARRNBasic
NLS Segment(s)
PositionSequence
402-417VKVEKKVRRPKRARRN
Subcellular Location(s) cyto 13.5, cyto_nucl 12.5, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011257  DNA_glycosylase  
IPR003265  HhH-GPD_domain  
IPR023170  HhH_base_excis_C  
IPR012904  OGG_N  
Gene Ontology GO:0140078  F:class I DNA-(apurinic or apyrimidinic site) endonuclease activity  
GO:0003684  F:damaged DNA binding  
GO:0008534  F:oxidized purine nucleobase lesion DNA N-glycosylase activity  
GO:0006285  P:base-excision repair, AP site formation  
GO:0006289  P:nucleotide-excision repair  
KEGG ztr:MYCGRDRAFT_71455  -  
Pfam View protein in Pfam  
PF00730  HhH-GPD  
PF07934  OGG_N  
CDD cd00056  ENDO3c  
Amino Acid Sequences MGGINLAEWQKLPMSLSELCINTTLRCGQSFRWRKNDLDVWSIALHNRILSLHQDPQYLYYRSIPPTTTTLTTPPTPPSSKPASPPSSSSSDDTLSLIHHYLNLEPNLTTLYAQWAASDANFARKAPQFTGIRILRQDAWEALIGFICSSNNNIARIGQMVHKLCIRYGPLLGYLDEEPYHDFPEPKDLAQDGVEAELRRLGFGYRAKYIYKTACMVSEKPDGWLDTLRNPETPILGVEPSDAGKWAAEGREGYRTAHAELLTLQGVGPKVADCVSLMGLGWGEAVPVDTHVWQIAVKDYKFGKGKHASLTKQTYDAVGNKFRSLWGKEAGWAHSVLFTADLKAFSERLVKKEEVKEEVKEESEEDEEVEPEQEVAVPVKQETASRRTVKRERDEDEDSKSVKVEKKVRRPKRARRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.21
4 0.25
5 0.24
6 0.24
7 0.25
8 0.25
9 0.21
10 0.23
11 0.25
12 0.21
13 0.23
14 0.25
15 0.29
16 0.39
17 0.48
18 0.53
19 0.58
20 0.6
21 0.59
22 0.66
23 0.68
24 0.61
25 0.57
26 0.49
27 0.42
28 0.4
29 0.38
30 0.3
31 0.25
32 0.21
33 0.15
34 0.15
35 0.13
36 0.13
37 0.16
38 0.2
39 0.25
40 0.27
41 0.29
42 0.28
43 0.33
44 0.38
45 0.35
46 0.32
47 0.31
48 0.33
49 0.34
50 0.36
51 0.33
52 0.29
53 0.31
54 0.33
55 0.3
56 0.26
57 0.27
58 0.28
59 0.3
60 0.29
61 0.29
62 0.32
63 0.33
64 0.33
65 0.36
66 0.4
67 0.4
68 0.44
69 0.5
70 0.49
71 0.48
72 0.5
73 0.48
74 0.46
75 0.45
76 0.41
77 0.34
78 0.29
79 0.28
80 0.25
81 0.2
82 0.15
83 0.15
84 0.13
85 0.1
86 0.1
87 0.1
88 0.12
89 0.17
90 0.17
91 0.16
92 0.15
93 0.15
94 0.15
95 0.15
96 0.13
97 0.08
98 0.11
99 0.12
100 0.12
101 0.11
102 0.11
103 0.11
104 0.11
105 0.13
106 0.1
107 0.15
108 0.16
109 0.16
110 0.2
111 0.24
112 0.27
113 0.25
114 0.33
115 0.28
116 0.28
117 0.38
118 0.35
119 0.34
120 0.32
121 0.33
122 0.26
123 0.26
124 0.26
125 0.16
126 0.16
127 0.15
128 0.14
129 0.12
130 0.1
131 0.09
132 0.08
133 0.08
134 0.07
135 0.05
136 0.06
137 0.11
138 0.12
139 0.13
140 0.13
141 0.13
142 0.14
143 0.14
144 0.14
145 0.13
146 0.17
147 0.17
148 0.18
149 0.2
150 0.2
151 0.19
152 0.2
153 0.19
154 0.15
155 0.14
156 0.14
157 0.14
158 0.14
159 0.14
160 0.13
161 0.12
162 0.11
163 0.11
164 0.1
165 0.11
166 0.1
167 0.12
168 0.1
169 0.11
170 0.1
171 0.18
172 0.19
173 0.16
174 0.17
175 0.16
176 0.16
177 0.15
178 0.16
179 0.08
180 0.08
181 0.1
182 0.08
183 0.08
184 0.09
185 0.09
186 0.08
187 0.08
188 0.07
189 0.1
190 0.13
191 0.16
192 0.17
193 0.18
194 0.19
195 0.2
196 0.24
197 0.21
198 0.2
199 0.19
200 0.17
201 0.18
202 0.2
203 0.2
204 0.21
205 0.23
206 0.21
207 0.21
208 0.22
209 0.19
210 0.18
211 0.19
212 0.16
213 0.15
214 0.2
215 0.19
216 0.18
217 0.19
218 0.18
219 0.16
220 0.15
221 0.12
222 0.09
223 0.08
224 0.08
225 0.07
226 0.07
227 0.07
228 0.07
229 0.07
230 0.05
231 0.05
232 0.06
233 0.07
234 0.07
235 0.07
236 0.08
237 0.09
238 0.14
239 0.15
240 0.15
241 0.16
242 0.17
243 0.17
244 0.19
245 0.17
246 0.13
247 0.13
248 0.14
249 0.11
250 0.1
251 0.09
252 0.08
253 0.08
254 0.08
255 0.08
256 0.06
257 0.07
258 0.07
259 0.07
260 0.05
261 0.06
262 0.07
263 0.07
264 0.06
265 0.06
266 0.06
267 0.05
268 0.05
269 0.04
270 0.03
271 0.03
272 0.04
273 0.04
274 0.05
275 0.06
276 0.06
277 0.06
278 0.07
279 0.07
280 0.07
281 0.08
282 0.12
283 0.17
284 0.17
285 0.22
286 0.22
287 0.29
288 0.33
289 0.34
290 0.37
291 0.39
292 0.42
293 0.46
294 0.52
295 0.48
296 0.52
297 0.58
298 0.5
299 0.45
300 0.42
301 0.35
302 0.32
303 0.34
304 0.31
305 0.32
306 0.32
307 0.3
308 0.3
309 0.31
310 0.33
311 0.3
312 0.29
313 0.27
314 0.26
315 0.3
316 0.33
317 0.32
318 0.28
319 0.25
320 0.22
321 0.18
322 0.18
323 0.13
324 0.12
325 0.1
326 0.11
327 0.11
328 0.12
329 0.12
330 0.13
331 0.13
332 0.13
333 0.22
334 0.22
335 0.24
336 0.3
337 0.31
338 0.37
339 0.44
340 0.48
341 0.46
342 0.47
343 0.47
344 0.44
345 0.45
346 0.4
347 0.33
348 0.29
349 0.24
350 0.22
351 0.19
352 0.18
353 0.15
354 0.14
355 0.14
356 0.14
357 0.11
358 0.09
359 0.09
360 0.08
361 0.08
362 0.1
363 0.1
364 0.11
365 0.11
366 0.14
367 0.14
368 0.18
369 0.23
370 0.26
371 0.34
372 0.41
373 0.46
374 0.54
375 0.61
376 0.67
377 0.72
378 0.75
379 0.71
380 0.71
381 0.74
382 0.69
383 0.68
384 0.64
385 0.55
386 0.47
387 0.44
388 0.43
389 0.41
390 0.45
391 0.48
392 0.52
393 0.62
394 0.72
395 0.81
396 0.86
397 0.91