Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9X4B7

Protein Details
Accession F9X4B7    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
29-49VDPSWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
34-50RKPKGIDNRVRRRFKGQ
Subcellular Location(s) mito 18, cyto 6, nucl 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ztr:MYCGRDRAFT_103191  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKKHVPIVKKVTARFNRHQSDRFMRVDPSWRKPKGIDNRVRRRFKGQAAMPKIGYGNNRKTRHMMPSGHKAFLVNNIRDLDLLLMHNRTYAAEIAHAVSSRKRIELVARAKQLGVKVTNGKAKITSES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.64
3 0.69
4 0.7
5 0.72
6 0.72
7 0.72
8 0.72
9 0.7
10 0.69
11 0.67
12 0.62
13 0.54
14 0.48
15 0.44
16 0.49
17 0.48
18 0.49
19 0.52
20 0.5
21 0.5
22 0.5
23 0.57
24 0.58
25 0.61
26 0.62
27 0.63
28 0.73
29 0.8
30 0.84
31 0.77
32 0.73
33 0.69
34 0.65
35 0.63
36 0.58
37 0.58
38 0.57
39 0.57
40 0.5
41 0.44
42 0.39
43 0.32
44 0.3
45 0.27
46 0.31
47 0.37
48 0.4
49 0.4
50 0.44
51 0.44
52 0.45
53 0.45
54 0.41
55 0.36
56 0.45
57 0.46
58 0.43
59 0.4
60 0.35
61 0.29
62 0.32
63 0.34
64 0.24
65 0.24
66 0.25
67 0.25
68 0.24
69 0.24
70 0.16
71 0.1
72 0.1
73 0.09
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.09
80 0.09
81 0.08
82 0.08
83 0.09
84 0.1
85 0.11
86 0.11
87 0.11
88 0.12
89 0.17
90 0.18
91 0.18
92 0.18
93 0.18
94 0.24
95 0.32
96 0.39
97 0.42
98 0.45
99 0.45
100 0.45
101 0.45
102 0.42
103 0.38
104 0.32
105 0.28
106 0.31
107 0.36
108 0.42
109 0.41
110 0.4
111 0.37