Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9X2M6

Protein Details
Accession F9X2M6    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
14-34STTPAQARKKGAPKKDPRITAHydrophilic
NLS Segment(s)
PositionSequence
21-30RKKGAPKKDP
Subcellular Location(s) mito 14, nucl 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR042831  YmL28  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG ztr:MYCGRDRAFT_28587  -  
Amino Acid Sequences LQTQSTQQNSLFSSTTPAQARKKGAPKKDPRITAIRYHLYHPKTPRPLHFSRNRALRHWTIHRAWQRHLDNQRRTRELDLERQYNAMASACEALRLIDDDGLTEQEAEHYGALQQRSEKEVGRLYRQAMMKDNVWDGVPIEYARMQTETPGRDGWNYGWTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.28
3 0.29
4 0.34
5 0.37
6 0.42
7 0.47
8 0.5
9 0.59
10 0.61
11 0.66
12 0.7
13 0.75
14 0.8
15 0.83
16 0.79
17 0.74
18 0.74
19 0.68
20 0.65
21 0.62
22 0.58
23 0.51
24 0.5
25 0.53
26 0.48
27 0.51
28 0.49
29 0.51
30 0.53
31 0.56
32 0.59
33 0.59
34 0.6
35 0.63
36 0.66
37 0.62
38 0.6
39 0.64
40 0.59
41 0.54
42 0.55
43 0.5
44 0.48
45 0.49
46 0.49
47 0.42
48 0.48
49 0.52
50 0.49
51 0.47
52 0.5
53 0.47
54 0.48
55 0.56
56 0.57
57 0.59
58 0.64
59 0.68
60 0.61
61 0.59
62 0.53
63 0.51
64 0.44
65 0.44
66 0.41
67 0.37
68 0.35
69 0.33
70 0.31
71 0.24
72 0.21
73 0.12
74 0.07
75 0.05
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.05
82 0.07
83 0.07
84 0.06
85 0.06
86 0.06
87 0.07
88 0.08
89 0.07
90 0.06
91 0.06
92 0.05
93 0.06
94 0.06
95 0.06
96 0.05
97 0.07
98 0.1
99 0.11
100 0.12
101 0.13
102 0.14
103 0.18
104 0.19
105 0.19
106 0.19
107 0.25
108 0.28
109 0.31
110 0.33
111 0.31
112 0.36
113 0.37
114 0.36
115 0.35
116 0.35
117 0.31
118 0.31
119 0.3
120 0.25
121 0.23
122 0.21
123 0.16
124 0.14
125 0.13
126 0.1
127 0.11
128 0.12
129 0.12
130 0.14
131 0.15
132 0.13
133 0.16
134 0.23
135 0.23
136 0.25
137 0.26
138 0.26
139 0.26
140 0.29
141 0.26