Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9XDF8

Protein Details
Accession F9XDF8   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
99-134EVCKTGMQSLKKRDRSKRKKDKSKKKKTTTGPETTKBasic
NLS Segment(s)
PositionSequence
109-125KKRDRSKRKKDKSKKKK
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG ztr:MYCGRDRAFT_43138  -  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences QFFTRLTTLLEKTQQAGHGSIYLTQKRLTFDTASAPSPPTGKVADDPLWDTHPPNPLPIIVRATDGNSQSKDRKKKDKVKLSTIVQPDDLETFFARYAEVCKTGMQSLKKRDRSKRKKDKSKKKKTTTGPETTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.27
4 0.23
5 0.2
6 0.2
7 0.23
8 0.27
9 0.26
10 0.25
11 0.26
12 0.27
13 0.28
14 0.29
15 0.28
16 0.23
17 0.21
18 0.26
19 0.27
20 0.26
21 0.24
22 0.23
23 0.21
24 0.2
25 0.19
26 0.15
27 0.13
28 0.13
29 0.13
30 0.17
31 0.18
32 0.18
33 0.2
34 0.19
35 0.21
36 0.2
37 0.2
38 0.18
39 0.22
40 0.21
41 0.2
42 0.19
43 0.17
44 0.18
45 0.19
46 0.18
47 0.13
48 0.14
49 0.13
50 0.15
51 0.16
52 0.16
53 0.17
54 0.16
55 0.18
56 0.23
57 0.3
58 0.37
59 0.41
60 0.5
61 0.58
62 0.67
63 0.75
64 0.8
65 0.79
66 0.79
67 0.8
68 0.73
69 0.7
70 0.63
71 0.54
72 0.44
73 0.37
74 0.29
75 0.22
76 0.19
77 0.13
78 0.1
79 0.1
80 0.09
81 0.09
82 0.08
83 0.07
84 0.1
85 0.11
86 0.12
87 0.12
88 0.13
89 0.14
90 0.18
91 0.23
92 0.28
93 0.33
94 0.42
95 0.52
96 0.6
97 0.68
98 0.75
99 0.81
100 0.86
101 0.89
102 0.9
103 0.91
104 0.94
105 0.96
106 0.97
107 0.97
108 0.97
109 0.97
110 0.96
111 0.95
112 0.94
113 0.94
114 0.92