Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UNQ2

Protein Details
Accession Q0UNQ2    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
62-99PSPSRPKTGTPPKKSPRDYHVPKRCDRKKCGSLREMNFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 7, cyto 7, cyto_mito 7
Family & Domain DBs
KEGG pno:SNOG_06612  -  
Amino Acid Sequences MAEAIVFALSSQATDPRDRVYGVLGLVELPTWGEALRLDYDLSACPVYQQATSCISLQYALPSPSRPKTGTPPKKSPRDYHVPKRCDRKKCGSLREMNFAAGMATR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.18
4 0.2
5 0.2
6 0.2
7 0.18
8 0.17
9 0.15
10 0.14
11 0.11
12 0.1
13 0.09
14 0.09
15 0.06
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.06
23 0.08
24 0.08
25 0.08
26 0.08
27 0.09
28 0.09
29 0.1
30 0.08
31 0.07
32 0.06
33 0.07
34 0.08
35 0.08
36 0.09
37 0.09
38 0.11
39 0.13
40 0.13
41 0.12
42 0.11
43 0.11
44 0.1
45 0.1
46 0.1
47 0.1
48 0.11
49 0.13
50 0.17
51 0.19
52 0.23
53 0.22
54 0.23
55 0.32
56 0.43
57 0.51
58 0.56
59 0.64
60 0.69
61 0.78
62 0.8
63 0.76
64 0.73
65 0.73
66 0.74
67 0.75
68 0.76
69 0.73
70 0.75
71 0.8
72 0.81
73 0.8
74 0.78
75 0.78
76 0.78
77 0.81
78 0.83
79 0.82
80 0.83
81 0.78
82 0.79
83 0.69
84 0.6
85 0.5
86 0.4