Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9XJI4

Protein Details
Accession F9XJI4    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
87-139ALHPRGSQPKPRRQLRSRRYRRRNDRPPAPRNRKSRSRRPPLRPSRQLPQQADBasic
NLS Segment(s)
PositionSequence
89-131HPRGSQPKPRRQLRSRRYRRRNDRPPAPRNRKSRSRRPPLRPS
Subcellular Location(s) nucl 24.5, cyto_nucl 14.5
Family & Domain DBs
KEGG ztr:MYCGRDRAFT_105694  -  
Amino Acid Sequences SSIRPSHYPVPRTRAQNNSNDCRLNCDLLQQHLHRRPPNYLHYTELSTLSTSPTSHRSITKDQQQHLQTTNNVLHNAKHPRQNPPQALHPRGSQPKPRRQLRSRRYRRRNDRPPAPRNRKSRSRRPPLRPSRQLPQQADHARQLQDGEGDSGGVGEGSGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.65
3 0.67
4 0.69
5 0.7
6 0.69
7 0.67
8 0.59
9 0.57
10 0.53
11 0.48
12 0.39
13 0.38
14 0.35
15 0.34
16 0.4
17 0.36
18 0.43
19 0.46
20 0.54
21 0.51
22 0.52
23 0.54
24 0.54
25 0.59
26 0.56
27 0.51
28 0.48
29 0.45
30 0.44
31 0.39
32 0.34
33 0.25
34 0.19
35 0.17
36 0.15
37 0.13
38 0.11
39 0.12
40 0.15
41 0.17
42 0.18
43 0.21
44 0.25
45 0.31
46 0.38
47 0.45
48 0.47
49 0.46
50 0.51
51 0.5
52 0.48
53 0.43
54 0.39
55 0.31
56 0.28
57 0.3
58 0.24
59 0.24
60 0.21
61 0.2
62 0.23
63 0.3
64 0.3
65 0.33
66 0.33
67 0.4
68 0.47
69 0.55
70 0.53
71 0.49
72 0.55
73 0.56
74 0.56
75 0.5
76 0.44
77 0.43
78 0.45
79 0.47
80 0.47
81 0.48
82 0.55
83 0.63
84 0.69
85 0.72
86 0.74
87 0.81
88 0.81
89 0.84
90 0.86
91 0.88
92 0.9
93 0.91
94 0.93
95 0.94
96 0.94
97 0.93
98 0.92
99 0.91
100 0.91
101 0.91
102 0.91
103 0.88
104 0.87
105 0.85
106 0.85
107 0.84
108 0.85
109 0.84
110 0.85
111 0.87
112 0.88
113 0.9
114 0.91
115 0.93
116 0.91
117 0.87
118 0.85
119 0.84
120 0.83
121 0.77
122 0.69
123 0.68
124 0.65
125 0.63
126 0.59
127 0.55
128 0.46
129 0.43
130 0.4
131 0.31
132 0.26
133 0.23
134 0.19
135 0.14
136 0.13
137 0.12
138 0.11
139 0.09
140 0.07