Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F9XGA1

Protein Details
Accession F9XGA1    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
59-84LSRLRTRTGRMTLKRRRAKGRSTLSHHydrophilic
NLS Segment(s)
PositionSequence
52-79RKRRHGFLSRLRTRTGRMTLKRRRAKGR
Subcellular Location(s) mito 12, nucl 9.5, cyto_nucl 7.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ztr:MYCGRDRAFT_45465  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPIRPTLLPTRSLLPASEVASSIVQPTSQTGLSILQVRGAKRDTFNPSHVVRKRRHGFLSRLRTRTGRMTLKRRRAKGRSTLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.22
4 0.21
5 0.17
6 0.16
7 0.15
8 0.15
9 0.13
10 0.1
11 0.08
12 0.08
13 0.09
14 0.09
15 0.09
16 0.09
17 0.09
18 0.09
19 0.1
20 0.14
21 0.12
22 0.14
23 0.16
24 0.16
25 0.18
26 0.19
27 0.19
28 0.17
29 0.22
30 0.24
31 0.25
32 0.27
33 0.3
34 0.3
35 0.38
36 0.42
37 0.44
38 0.42
39 0.5
40 0.54
41 0.55
42 0.59
43 0.56
44 0.59
45 0.63
46 0.7
47 0.68
48 0.65
49 0.62
50 0.58
51 0.55
52 0.54
53 0.52
54 0.51
55 0.52
56 0.6
57 0.67
58 0.76
59 0.82
60 0.83
61 0.85
62 0.83
63 0.83
64 0.83