Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7TSR7

Protein Details
Accession A7TSR7    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
26-60AKEFRFCRSKGHKNFKQRRNPRKLRWTKTFKKSAGHydrophilic
NLS Segment(s)
PositionSequence
34-62SKGHKNFKQRRNPRKLRWTKTFKKSAGKK
Subcellular Location(s) mito 18.5, mito_nucl 13, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR023442  Ribosomal_L24e_CS  
IPR011017  TRASH_dom  
Gene Ontology GO:0042254  P:ribosome biogenesis  
KEGG vpo:Kpol_344p1  -  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
PROSITE View protein in PROSITE  
PS01073  RIBOSOMAL_L24E  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKGHKNFKQRRNPRKLRWTKTFKKSAGKKWAVDSTLNLCTKRNVPGKYNKNLVPTTLKAMSEIEEFCPILGKTLLINKMEGNKKGNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.31
4 0.29
5 0.26
6 0.21
7 0.21
8 0.18
9 0.2
10 0.19
11 0.19
12 0.19
13 0.21
14 0.27
15 0.26
16 0.3
17 0.35
18 0.35
19 0.44
20 0.51
21 0.59
22 0.62
23 0.71
24 0.73
25 0.77
26 0.87
27 0.87
28 0.88
29 0.88
30 0.88
31 0.89
32 0.91
33 0.89
34 0.9
35 0.91
36 0.88
37 0.88
38 0.87
39 0.85
40 0.84
41 0.83
42 0.76
43 0.75
44 0.74
45 0.73
46 0.74
47 0.69
48 0.61
49 0.56
50 0.55
51 0.47
52 0.4
53 0.33
54 0.26
55 0.29
56 0.29
57 0.25
58 0.22
59 0.22
60 0.23
61 0.3
62 0.33
63 0.29
64 0.34
65 0.44
66 0.51
67 0.56
68 0.6
69 0.55
70 0.54
71 0.51
72 0.48
73 0.43
74 0.37
75 0.36
76 0.33
77 0.3
78 0.25
79 0.25
80 0.24
81 0.2
82 0.2
83 0.16
84 0.15
85 0.15
86 0.14
87 0.17
88 0.15
89 0.15
90 0.14
91 0.13
92 0.13
93 0.2
94 0.24
95 0.22
96 0.23
97 0.23
98 0.32
99 0.38
100 0.41