Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UM69

Protein Details
Accession Q0UM69   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
38-60RVSLRNAIRNKFRRNRNLQSPYLHydrophilic
266-289GQTIIRGRKKRPIKVIKPPKPRSQBasic
NLS Segment(s)
PositionSequence
271-289RGRKKRPIKVIKPPKPRSQ
Subcellular Location(s) mito 22.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008011  Complex1_LYR_dom  
IPR046896  Cup1-like_N  
KEGG pno:SNOG_07145  -  
Pfam View protein in Pfam  
PF05347  Complex1_LYR  
CDD cd20273  Complex1_LYR_unchar  
Amino Acid Sequences MPRFLQPKNSTQHRVAAIALYRALLSRCSSAPLADDDRVSLRNAIRNKFRRNRNLQSPYLLGLSYKAGYETLDHLDASSNGNSASLDILKQLVPQLSKSITRTPRPRVYPAPISPPKERLSCLPPERAVLNVRPFAKTSGPRRVPIIATANGVPFLRLTKPQPPALSRMLRQRLTSKMNLFNVKVTLGNWWLPMAQQEDEWDALVNTRAGRKLDAEEEKVQWVDAIKMSERENQAAYEKDLAKDRAYIRKMQRIVDLETKLALEEGQTIIRGRKKRPIKVIKPPKPRSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.46
3 0.41
4 0.35
5 0.3
6 0.28
7 0.21
8 0.18
9 0.18
10 0.18
11 0.15
12 0.14
13 0.15
14 0.15
15 0.19
16 0.19
17 0.18
18 0.2
19 0.23
20 0.25
21 0.24
22 0.23
23 0.21
24 0.23
25 0.24
26 0.23
27 0.22
28 0.2
29 0.25
30 0.31
31 0.37
32 0.45
33 0.52
34 0.62
35 0.67
36 0.74
37 0.78
38 0.82
39 0.85
40 0.85
41 0.85
42 0.77
43 0.73
44 0.65
45 0.56
46 0.47
47 0.37
48 0.26
49 0.19
50 0.17
51 0.13
52 0.11
53 0.09
54 0.08
55 0.09
56 0.1
57 0.12
58 0.13
59 0.13
60 0.13
61 0.13
62 0.13
63 0.14
64 0.15
65 0.13
66 0.1
67 0.09
68 0.09
69 0.09
70 0.08
71 0.09
72 0.07
73 0.06
74 0.06
75 0.08
76 0.08
77 0.08
78 0.1
79 0.11
80 0.11
81 0.12
82 0.14
83 0.15
84 0.18
85 0.2
86 0.27
87 0.31
88 0.38
89 0.45
90 0.5
91 0.56
92 0.58
93 0.61
94 0.58
95 0.59
96 0.59
97 0.54
98 0.56
99 0.54
100 0.55
101 0.51
102 0.5
103 0.47
104 0.4
105 0.39
106 0.32
107 0.31
108 0.34
109 0.35
110 0.34
111 0.32
112 0.31
113 0.31
114 0.29
115 0.27
116 0.23
117 0.23
118 0.23
119 0.24
120 0.23
121 0.23
122 0.23
123 0.25
124 0.28
125 0.3
126 0.36
127 0.38
128 0.38
129 0.39
130 0.39
131 0.35
132 0.32
133 0.3
134 0.21
135 0.19
136 0.19
137 0.17
138 0.16
139 0.15
140 0.12
141 0.07
142 0.08
143 0.08
144 0.1
145 0.13
146 0.19
147 0.23
148 0.26
149 0.29
150 0.29
151 0.33
152 0.37
153 0.38
154 0.34
155 0.4
156 0.43
157 0.42
158 0.42
159 0.41
160 0.41
161 0.42
162 0.44
163 0.4
164 0.39
165 0.42
166 0.44
167 0.4
168 0.36
169 0.32
170 0.27
171 0.23
172 0.17
173 0.14
174 0.13
175 0.13
176 0.12
177 0.11
178 0.11
179 0.1
180 0.12
181 0.13
182 0.11
183 0.1
184 0.11
185 0.13
186 0.13
187 0.13
188 0.11
189 0.08
190 0.08
191 0.09
192 0.09
193 0.08
194 0.11
195 0.13
196 0.14
197 0.15
198 0.16
199 0.18
200 0.24
201 0.28
202 0.31
203 0.31
204 0.32
205 0.33
206 0.31
207 0.28
208 0.21
209 0.17
210 0.14
211 0.13
212 0.14
213 0.14
214 0.16
215 0.19
216 0.24
217 0.26
218 0.26
219 0.25
220 0.24
221 0.26
222 0.25
223 0.25
224 0.26
225 0.25
226 0.25
227 0.3
228 0.3
229 0.28
230 0.32
231 0.35
232 0.37
233 0.39
234 0.45
235 0.47
236 0.55
237 0.57
238 0.54
239 0.56
240 0.51
241 0.54
242 0.53
243 0.48
244 0.39
245 0.37
246 0.34
247 0.26
248 0.22
249 0.16
250 0.09
251 0.09
252 0.1
253 0.1
254 0.11
255 0.13
256 0.19
257 0.26
258 0.31
259 0.34
260 0.43
261 0.52
262 0.6
263 0.7
264 0.75
265 0.78
266 0.84
267 0.9
268 0.91
269 0.92