Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UGA8

Protein Details
Accession Q0UGA8    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
29-53TQPTQRQKQKHITQRPQSHKPLRLPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
KEGG pno:SNOG_09206  -  
Amino Acid Sequences MPSYSYPLRKDNSDELRDRGPGSVSISITQPTQRQKQKHITQRPQSHKPLRLPSLNLKIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.49
3 0.48
4 0.47
5 0.41
6 0.33
7 0.25
8 0.19
9 0.19
10 0.19
11 0.16
12 0.16
13 0.16
14 0.16
15 0.15
16 0.15
17 0.16
18 0.18
19 0.26
20 0.32
21 0.35
22 0.42
23 0.52
24 0.59
25 0.66
26 0.72
27 0.74
28 0.78
29 0.85
30 0.86
31 0.84
32 0.85
33 0.84
34 0.8
35 0.78
36 0.78
37 0.74
38 0.71
39 0.69
40 0.68