Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0U3K9

Protein Details
Accession Q0U3K9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
107-128EVVEKKKNKKGRYPWHKTRLLLBasic
NLS Segment(s)
PositionSequence
111-118KKKNKKGR
Subcellular Location(s) plas 26
Family & Domain DBs
KEGG pno:SNOG_13655  -  
Amino Acid Sequences MSKQDPLPETPIAEHDYALTSLSTMKQVPQSPARPATPHCPPSIHEPHAPPPIPPRSLQRPVSVLTAPAERHLIALEHWRCNLPTSFYEPQEHAWGIAKAPAEERVEVVEKKKNKKGRYPWHKTRLLLRFMGSCFILTAIALVYLRFNGSYRFSDPYRFSDPYRFNDSYRFNDSYRFNDSYDFFTLWVYMVCPAALTYNIAEMLCGFIVGRGINRCVNTGMDGLFTIGLVGIGFRFVAEAHGVKGDDVIGAICILGGVLQAGVWAYGICSFCK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.19
3 0.19
4 0.17
5 0.17
6 0.13
7 0.1
8 0.11
9 0.12
10 0.14
11 0.12
12 0.15
13 0.2
14 0.25
15 0.31
16 0.37
17 0.41
18 0.45
19 0.5
20 0.51
21 0.48
22 0.48
23 0.49
24 0.5
25 0.49
26 0.44
27 0.41
28 0.39
29 0.45
30 0.5
31 0.48
32 0.43
33 0.44
34 0.48
35 0.55
36 0.54
37 0.45
38 0.45
39 0.47
40 0.44
41 0.42
42 0.43
43 0.44
44 0.52
45 0.53
46 0.49
47 0.45
48 0.45
49 0.46
50 0.39
51 0.31
52 0.24
53 0.24
54 0.2
55 0.19
56 0.18
57 0.15
58 0.14
59 0.13
60 0.12
61 0.09
62 0.19
63 0.22
64 0.22
65 0.23
66 0.24
67 0.24
68 0.26
69 0.27
70 0.21
71 0.19
72 0.25
73 0.28
74 0.29
75 0.32
76 0.29
77 0.29
78 0.29
79 0.27
80 0.2
81 0.18
82 0.16
83 0.14
84 0.16
85 0.14
86 0.11
87 0.12
88 0.16
89 0.14
90 0.14
91 0.14
92 0.14
93 0.17
94 0.17
95 0.2
96 0.21
97 0.26
98 0.33
99 0.4
100 0.44
101 0.47
102 0.55
103 0.63
104 0.68
105 0.74
106 0.77
107 0.81
108 0.83
109 0.83
110 0.75
111 0.73
112 0.68
113 0.61
114 0.52
115 0.42
116 0.35
117 0.31
118 0.3
119 0.21
120 0.14
121 0.1
122 0.09
123 0.08
124 0.05
125 0.05
126 0.03
127 0.04
128 0.04
129 0.03
130 0.03
131 0.04
132 0.04
133 0.04
134 0.04
135 0.06
136 0.09
137 0.11
138 0.13
139 0.16
140 0.17
141 0.21
142 0.23
143 0.27
144 0.31
145 0.3
146 0.3
147 0.35
148 0.39
149 0.39
150 0.45
151 0.41
152 0.36
153 0.41
154 0.44
155 0.41
156 0.43
157 0.4
158 0.32
159 0.37
160 0.38
161 0.35
162 0.37
163 0.34
164 0.28
165 0.28
166 0.29
167 0.27
168 0.28
169 0.24
170 0.18
171 0.16
172 0.16
173 0.13
174 0.12
175 0.08
176 0.06
177 0.06
178 0.06
179 0.06
180 0.06
181 0.06
182 0.06
183 0.07
184 0.06
185 0.07
186 0.08
187 0.08
188 0.08
189 0.07
190 0.07
191 0.06
192 0.06
193 0.05
194 0.04
195 0.06
196 0.06
197 0.09
198 0.1
199 0.13
200 0.16
201 0.17
202 0.18
203 0.19
204 0.19
205 0.18
206 0.17
207 0.15
208 0.13
209 0.12
210 0.11
211 0.1
212 0.08
213 0.06
214 0.05
215 0.05
216 0.04
217 0.04
218 0.03
219 0.03
220 0.04
221 0.03
222 0.04
223 0.04
224 0.06
225 0.08
226 0.09
227 0.1
228 0.13
229 0.13
230 0.13
231 0.13
232 0.12
233 0.09
234 0.09
235 0.08
236 0.05
237 0.05
238 0.05
239 0.04
240 0.04
241 0.04
242 0.03
243 0.03
244 0.03
245 0.03
246 0.03
247 0.03
248 0.04
249 0.04
250 0.04
251 0.04
252 0.04
253 0.08