Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9X031

Protein Details
Accession F9X031   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
34-53RTDESCPQPKHRRAQSPSRVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 5, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
KEGG ztr:MYCGRDRAFT_102437  -  
Amino Acid Sequences MPAHQLDKVGTFTLVTWFCLLKRDSNEHLVRTSRTDESCPQPKHRRAQSPSRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.14
4 0.14
5 0.14
6 0.18
7 0.19
8 0.17
9 0.21
10 0.26
11 0.27
12 0.35
13 0.37
14 0.33
15 0.35
16 0.32
17 0.29
18 0.27
19 0.27
20 0.23
21 0.22
22 0.25
23 0.27
24 0.33
25 0.42
26 0.44
27 0.5
28 0.57
29 0.64
30 0.7
31 0.75
32 0.78
33 0.76