Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0V1W9

Protein Details
Accession Q0V1W9    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
41-64EWRASRKGKLRKHRLTYKERAERQBasic
NLS Segment(s)
PositionSequence
45-55SRKGKLRKHRL
Subcellular Location(s) nucl 17.5, mito_nucl 12, mito 5.5, cyto 4
Family & Domain DBs
KEGG pno:SNOG_01995  -  
Amino Acid Sequences MFRRLSERLSFEKPEPKPYYYNRMNPEEMQIWEIIGETEDEWRASRKGKLRKHRLTYKERAERQRMFYDTRVGHGICGDDWMRKALPGQRRAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.53
3 0.5
4 0.51
5 0.52
6 0.58
7 0.57
8 0.62
9 0.58
10 0.59
11 0.58
12 0.52
13 0.52
14 0.44
15 0.37
16 0.3
17 0.24
18 0.18
19 0.14
20 0.14
21 0.09
22 0.06
23 0.05
24 0.04
25 0.05
26 0.06
27 0.06
28 0.06
29 0.08
30 0.09
31 0.11
32 0.15
33 0.22
34 0.31
35 0.4
36 0.5
37 0.59
38 0.68
39 0.75
40 0.8
41 0.81
42 0.81
43 0.82
44 0.81
45 0.8
46 0.79
47 0.78
48 0.77
49 0.73
50 0.7
51 0.67
52 0.6
53 0.55
54 0.49
55 0.49
56 0.41
57 0.38
58 0.36
59 0.29
60 0.26
61 0.23
62 0.22
63 0.13
64 0.17
65 0.15
66 0.14
67 0.15
68 0.18
69 0.17
70 0.17
71 0.22
72 0.25
73 0.33