Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9X9J5

Protein Details
Accession F9X9J5    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
354-374REFPVRKPRTEVYKQRRERRYBasic
NLS Segment(s)
PositionSequence
328-373RASKPLRGQRGFRRGAKVFPDHARHPREFPVRKPRTEVYKQRRERR
Subcellular Location(s) cyto 11, nucl 9, pero 4, mito 3
Family & Domain DBs
KEGG ztr:MYCGRDRAFT_92512  -  
Amino Acid Sequences MAYLFRVYSDQSNGFNDRFEFKPASAIFGPAPGMTLEAQLIIALSGKLIAPHNPYIFWTISLHLALQLAHKRQAAGEINIRIAFLDVKASRTPAGGLLQFESVASFAARLGLALKKDRDGTPRGLAEFVTMDSVVVKGDSRTASFDALISNGLYKLYPSIEQAAGMRSGSGFNLELRLLQQLYYDPGRKWSLSRTKIALAAKIASAFVAKDVSTCKVANQVLGFFLSLQNRDMDDQKALRAWSKTNTKPEVIDLTEASGIEIIDITHDSKFDISNPEMDTFRSTSAILKGRTILDSVLGMCTTVPEREIRAEVELWHKQREENYAAHRASKPLRGQRGFRRGAKVFPDHARHPREFPVRKPRTEVYKQRRERRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.31
4 0.3
5 0.28
6 0.3
7 0.29
8 0.25
9 0.32
10 0.3
11 0.35
12 0.31
13 0.32
14 0.26
15 0.25
16 0.26
17 0.17
18 0.18
19 0.11
20 0.12
21 0.1
22 0.11
23 0.09
24 0.08
25 0.08
26 0.07
27 0.07
28 0.06
29 0.06
30 0.05
31 0.05
32 0.05
33 0.05
34 0.08
35 0.09
36 0.13
37 0.17
38 0.23
39 0.24
40 0.24
41 0.25
42 0.27
43 0.26
44 0.24
45 0.21
46 0.17
47 0.18
48 0.18
49 0.16
50 0.13
51 0.13
52 0.12
53 0.16
54 0.21
55 0.22
56 0.26
57 0.27
58 0.26
59 0.26
60 0.33
61 0.31
62 0.29
63 0.33
64 0.31
65 0.32
66 0.32
67 0.31
68 0.24
69 0.2
70 0.16
71 0.1
72 0.15
73 0.13
74 0.16
75 0.17
76 0.19
77 0.18
78 0.18
79 0.19
80 0.14
81 0.17
82 0.15
83 0.16
84 0.16
85 0.15
86 0.15
87 0.14
88 0.12
89 0.08
90 0.07
91 0.06
92 0.05
93 0.04
94 0.05
95 0.05
96 0.05
97 0.07
98 0.09
99 0.11
100 0.16
101 0.17
102 0.18
103 0.21
104 0.24
105 0.27
106 0.29
107 0.31
108 0.32
109 0.33
110 0.32
111 0.3
112 0.27
113 0.23
114 0.19
115 0.15
116 0.1
117 0.08
118 0.07
119 0.06
120 0.07
121 0.05
122 0.05
123 0.05
124 0.04
125 0.07
126 0.08
127 0.08
128 0.11
129 0.12
130 0.12
131 0.12
132 0.12
133 0.1
134 0.1
135 0.09
136 0.07
137 0.06
138 0.06
139 0.06
140 0.05
141 0.05
142 0.06
143 0.06
144 0.07
145 0.08
146 0.1
147 0.1
148 0.11
149 0.11
150 0.12
151 0.11
152 0.1
153 0.09
154 0.06
155 0.06
156 0.06
157 0.06
158 0.06
159 0.05
160 0.07
161 0.07
162 0.07
163 0.07
164 0.09
165 0.08
166 0.07
167 0.07
168 0.07
169 0.09
170 0.12
171 0.13
172 0.12
173 0.16
174 0.17
175 0.17
176 0.18
177 0.24
178 0.31
179 0.33
180 0.36
181 0.34
182 0.34
183 0.38
184 0.38
185 0.31
186 0.23
187 0.2
188 0.17
189 0.15
190 0.13
191 0.08
192 0.08
193 0.06
194 0.05
195 0.05
196 0.05
197 0.05
198 0.07
199 0.09
200 0.11
201 0.11
202 0.11
203 0.16
204 0.17
205 0.17
206 0.17
207 0.15
208 0.14
209 0.14
210 0.14
211 0.08
212 0.1
213 0.1
214 0.1
215 0.11
216 0.11
217 0.11
218 0.13
219 0.14
220 0.13
221 0.15
222 0.15
223 0.15
224 0.16
225 0.16
226 0.19
227 0.18
228 0.19
229 0.23
230 0.31
231 0.36
232 0.42
233 0.45
234 0.43
235 0.42
236 0.43
237 0.4
238 0.32
239 0.28
240 0.2
241 0.18
242 0.17
243 0.16
244 0.13
245 0.09
246 0.08
247 0.06
248 0.06
249 0.04
250 0.04
251 0.05
252 0.06
253 0.06
254 0.06
255 0.07
256 0.08
257 0.08
258 0.1
259 0.15
260 0.14
261 0.18
262 0.2
263 0.22
264 0.21
265 0.22
266 0.22
267 0.19
268 0.19
269 0.16
270 0.14
271 0.15
272 0.21
273 0.26
274 0.24
275 0.24
276 0.25
277 0.26
278 0.26
279 0.24
280 0.18
281 0.13
282 0.13
283 0.12
284 0.11
285 0.09
286 0.08
287 0.07
288 0.09
289 0.09
290 0.08
291 0.09
292 0.1
293 0.12
294 0.15
295 0.17
296 0.17
297 0.18
298 0.19
299 0.2
300 0.27
301 0.32
302 0.32
303 0.35
304 0.34
305 0.34
306 0.37
307 0.41
308 0.38
309 0.36
310 0.4
311 0.45
312 0.45
313 0.48
314 0.45
315 0.45
316 0.45
317 0.47
318 0.49
319 0.5
320 0.59
321 0.6
322 0.66
323 0.71
324 0.77
325 0.77
326 0.75
327 0.74
328 0.66
329 0.67
330 0.67
331 0.63
332 0.59
333 0.59
334 0.6
335 0.59
336 0.66
337 0.67
338 0.63
339 0.6
340 0.63
341 0.65
342 0.64
343 0.67
344 0.69
345 0.7
346 0.71
347 0.74
348 0.72
349 0.71
350 0.75
351 0.77
352 0.76
353 0.78
354 0.84