Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F9WXZ4

Protein Details
Accession F9WXZ4    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
111-135TTSTPKPKATPKKRARSELKKEDTGHydrophilic
140-162DESPVKKVKATPKKGRGKKAVGEBasic
NLS Segment(s)
PositionSequence
116-131KPKATPKKRARSELKK
144-158VKKVKATPKKGRGKK
Subcellular Location(s) cyto 19, cyto_nucl 13.5, nucl 6
Family & Domain DBs
KEGG ztr:MYCGRDRAFT_89322  -  
Amino Acid Sequences MATNDFTPREDEIMAAAWRCFEGGEPKVDFKKLAPLVGMGNPGSAKNAWAKIKKKLAAAFEGEPKVDFKKLAPLVDMGNPGSAKNAWAKIKKKLAARALEVAGDTEAMTTTTSTPKPKATPKKRARSELKKEDTGSDDGDESPVKKVKATPKKGRGKKAVGELVGSDDEKVDERVDEVVGVEEVPVKAGAVDADHSVDTGDLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.15
4 0.13
5 0.13
6 0.13
7 0.11
8 0.09
9 0.15
10 0.17
11 0.23
12 0.25
13 0.29
14 0.32
15 0.33
16 0.32
17 0.26
18 0.33
19 0.29
20 0.28
21 0.24
22 0.23
23 0.24
24 0.25
25 0.27
26 0.17
27 0.16
28 0.15
29 0.14
30 0.15
31 0.12
32 0.12
33 0.14
34 0.2
35 0.26
36 0.33
37 0.37
38 0.44
39 0.52
40 0.54
41 0.55
42 0.54
43 0.51
44 0.47
45 0.47
46 0.41
47 0.39
48 0.36
49 0.31
50 0.26
51 0.24
52 0.22
53 0.19
54 0.16
55 0.11
56 0.2
57 0.23
58 0.23
59 0.22
60 0.22
61 0.22
62 0.24
63 0.25
64 0.15
65 0.14
66 0.13
67 0.12
68 0.12
69 0.11
70 0.1
71 0.13
72 0.19
73 0.24
74 0.32
75 0.36
76 0.44
77 0.52
78 0.55
79 0.55
80 0.57
81 0.56
82 0.52
83 0.5
84 0.45
85 0.36
86 0.32
87 0.27
88 0.2
89 0.14
90 0.1
91 0.07
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.05
98 0.08
99 0.1
100 0.12
101 0.14
102 0.17
103 0.21
104 0.31
105 0.41
106 0.48
107 0.57
108 0.65
109 0.74
110 0.78
111 0.84
112 0.85
113 0.84
114 0.85
115 0.85
116 0.81
117 0.74
118 0.69
119 0.61
120 0.54
121 0.45
122 0.36
123 0.26
124 0.21
125 0.16
126 0.16
127 0.15
128 0.12
129 0.13
130 0.16
131 0.15
132 0.15
133 0.21
134 0.3
135 0.41
136 0.5
137 0.57
138 0.64
139 0.75
140 0.82
141 0.86
142 0.85
143 0.81
144 0.77
145 0.76
146 0.71
147 0.61
148 0.54
149 0.44
150 0.39
151 0.33
152 0.27
153 0.18
154 0.12
155 0.12
156 0.12
157 0.13
158 0.1
159 0.08
160 0.09
161 0.1
162 0.1
163 0.1
164 0.09
165 0.09
166 0.08
167 0.08
168 0.07
169 0.09
170 0.08
171 0.09
172 0.09
173 0.08
174 0.07
175 0.08
176 0.08
177 0.07
178 0.08
179 0.08
180 0.1
181 0.1
182 0.1
183 0.1