Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9XNB6

Protein Details
Accession F9XNB6    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
47-86LSPCPERRRYGRHHRTPQQLRRLHIRPRDRQRRQRPIQVGBasic
NLS Segment(s)
PositionSequence
33-82KPHPRGPPHHLRPRLSPCPERRRYGRHHRTPQQLRRLHIRPRDRQRRQRP
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 5, cyto 2
Family & Domain DBs
KEGG ztr:MYCGRDRAFT_106176  -  
Amino Acid Sequences NNIQQPTTNNIQQPTTLPNNIHSTHHHNALHSKPHPRGPPHHLRPRLSPCPERRRYGRHHRTPQQLRRLHIRPRDRQRRQRPIQVGLPAAPRRLHRQTEQVLAHLRPSHHWYRSHLPILRDGGCLRYVRLDRTGRHYGSNEGLVELVEGWRNDAGSGRDAGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.33
4 0.3
5 0.32
6 0.36
7 0.37
8 0.37
9 0.35
10 0.38
11 0.38
12 0.45
13 0.41
14 0.37
15 0.42
16 0.45
17 0.49
18 0.45
19 0.49
20 0.46
21 0.52
22 0.57
23 0.56
24 0.59
25 0.59
26 0.65
27 0.67
28 0.73
29 0.73
30 0.69
31 0.73
32 0.74
33 0.74
34 0.7
35 0.68
36 0.68
37 0.72
38 0.74
39 0.72
40 0.69
41 0.67
42 0.7
43 0.73
44 0.74
45 0.74
46 0.78
47 0.8
48 0.85
49 0.88
50 0.87
51 0.85
52 0.79
53 0.71
54 0.69
55 0.67
56 0.64
57 0.61
58 0.62
59 0.61
60 0.68
61 0.77
62 0.78
63 0.83
64 0.86
65 0.88
66 0.85
67 0.85
68 0.78
69 0.72
70 0.67
71 0.59
72 0.49
73 0.4
74 0.4
75 0.32
76 0.29
77 0.26
78 0.23
79 0.27
80 0.31
81 0.33
82 0.3
83 0.36
84 0.38
85 0.43
86 0.42
87 0.38
88 0.36
89 0.33
90 0.33
91 0.28
92 0.25
93 0.2
94 0.26
95 0.29
96 0.3
97 0.33
98 0.36
99 0.4
100 0.47
101 0.52
102 0.5
103 0.44
104 0.45
105 0.47
106 0.43
107 0.38
108 0.31
109 0.26
110 0.25
111 0.24
112 0.19
113 0.22
114 0.22
115 0.23
116 0.31
117 0.34
118 0.34
119 0.42
120 0.49
121 0.44
122 0.46
123 0.45
124 0.41
125 0.39
126 0.4
127 0.32
128 0.24
129 0.23
130 0.18
131 0.17
132 0.13
133 0.11
134 0.1
135 0.1
136 0.11
137 0.11
138 0.12
139 0.12
140 0.15
141 0.16
142 0.16