Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9WYQ2

Protein Details
Accession F9WYQ2   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-25VTTNNPKNDTKGKKRVRSIAAHydrophilic
NLS Segment(s)
PositionSequence
15-36KGKKRVRSIAALKGWPERRRRA
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 5, cyto 3
Family & Domain DBs
KEGG ztr:MYCGRDRAFT_106800  -  
Amino Acid Sequences MEFIVTTNNPKNDTKGKKRVRSIAALKGWPERRRRAFEHLEDRQARVARKNDEGGLSSVWKTVRRELLARTTKEDFRASGRPSGESGSQERRPNTTPEQSCFRAASNSFIAKSSTTAANRRPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.61
3 0.69
4 0.74
5 0.81
6 0.84
7 0.79
8 0.79
9 0.75
10 0.73
11 0.69
12 0.62
13 0.56
14 0.56
15 0.57
16 0.54
17 0.55
18 0.55
19 0.57
20 0.61
21 0.64
22 0.64
23 0.65
24 0.67
25 0.7
26 0.64
27 0.66
28 0.6
29 0.56
30 0.52
31 0.47
32 0.4
33 0.37
34 0.38
35 0.32
36 0.34
37 0.34
38 0.31
39 0.29
40 0.28
41 0.23
42 0.18
43 0.16
44 0.13
45 0.13
46 0.13
47 0.15
48 0.14
49 0.17
50 0.2
51 0.2
52 0.22
53 0.23
54 0.32
55 0.36
56 0.35
57 0.36
58 0.36
59 0.35
60 0.37
61 0.35
62 0.26
63 0.24
64 0.29
65 0.27
66 0.29
67 0.28
68 0.27
69 0.26
70 0.28
71 0.25
72 0.21
73 0.24
74 0.26
75 0.32
76 0.36
77 0.36
78 0.38
79 0.39
80 0.42
81 0.44
82 0.47
83 0.45
84 0.44
85 0.5
86 0.48
87 0.49
88 0.44
89 0.39
90 0.35
91 0.31
92 0.32
93 0.3
94 0.31
95 0.29
96 0.29
97 0.29
98 0.23
99 0.24
100 0.22
101 0.23
102 0.25
103 0.3