Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9X0S6

Protein Details
Accession F9X0S6   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
101-127AEAKLVTEKQKKRQRHFPQRNFAVKAIHydrophilic
NLS Segment(s)
PositionSequence
89-115KQTRAIRRRLSPAEAKLVTEKQKKRQR
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG ztr:MYCGRDRAFT_102922  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSTSGKVKAAQLWGKNKDELQKQLDELKQELVQLRTQKIAGGAQSKLNKIHDVRKSIARVLTIINANQRSQLRLFYKNKKYMPLDLRPKQTRAIRRRLSPAEAKLVTEKQKKRQRHFPQRNFAVKAIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.55
3 0.53
4 0.52
5 0.52
6 0.52
7 0.47
8 0.44
9 0.42
10 0.47
11 0.46
12 0.41
13 0.35
14 0.31
15 0.27
16 0.26
17 0.27
18 0.22
19 0.24
20 0.25
21 0.26
22 0.24
23 0.24
24 0.22
25 0.2
26 0.2
27 0.18
28 0.17
29 0.17
30 0.21
31 0.24
32 0.25
33 0.26
34 0.25
35 0.26
36 0.26
37 0.33
38 0.32
39 0.34
40 0.35
41 0.38
42 0.39
43 0.37
44 0.36
45 0.28
46 0.24
47 0.2
48 0.2
49 0.15
50 0.14
51 0.16
52 0.16
53 0.15
54 0.19
55 0.18
56 0.17
57 0.17
58 0.22
59 0.22
60 0.29
61 0.37
62 0.43
63 0.51
64 0.57
65 0.58
66 0.59
67 0.58
68 0.58
69 0.58
70 0.58
71 0.6
72 0.58
73 0.66
74 0.63
75 0.62
76 0.61
77 0.6
78 0.61
79 0.59
80 0.64
81 0.61
82 0.63
83 0.7
84 0.67
85 0.67
86 0.64
87 0.59
88 0.57
89 0.51
90 0.47
91 0.43
92 0.44
93 0.46
94 0.49
95 0.51
96 0.53
97 0.62
98 0.71
99 0.74
100 0.8
101 0.82
102 0.85
103 0.9
104 0.9
105 0.92
106 0.92
107 0.92
108 0.85