Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9XHS0

Protein Details
Accession F9XHS0   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
132-156AGVPKTPAPKKRTARKTVIKAENMDHydrophilic
NLS Segment(s)
PositionSequence
84-86KKR
108-115KKQGRGKK
141-143KKR
Subcellular Location(s) cyto_nucl 11.833, cyto 11, nucl 10.5, mito_nucl 8.166, mito 4.5
Family & Domain DBs
KEGG ztr:MYCGRDRAFT_94872  -  
Amino Acid Sequences MSYNYQIAKDAISQPEKDRAFCIFLNTTNGVTNWEKATTDFKSASVDSMKVSWRNTLKKIEKAGGKLDGGDTSTTPATPKSSAKKRKVKEEDSANDGEDVAPTTPAPKKQGRGKKAAASTIEKSDDGEYVEAGVPKTPAPKKRTARKTVIKAENMDDVEGADDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.42
3 0.42
4 0.39
5 0.36
6 0.31
7 0.32
8 0.3
9 0.32
10 0.25
11 0.26
12 0.3
13 0.29
14 0.27
15 0.25
16 0.24
17 0.23
18 0.22
19 0.22
20 0.18
21 0.18
22 0.17
23 0.17
24 0.23
25 0.2
26 0.23
27 0.21
28 0.2
29 0.23
30 0.22
31 0.23
32 0.2
33 0.18
34 0.14
35 0.16
36 0.19
37 0.18
38 0.19
39 0.22
40 0.27
41 0.32
42 0.35
43 0.43
44 0.46
45 0.48
46 0.51
47 0.51
48 0.48
49 0.45
50 0.44
51 0.37
52 0.31
53 0.26
54 0.23
55 0.17
56 0.15
57 0.12
58 0.09
59 0.08
60 0.08
61 0.08
62 0.07
63 0.08
64 0.09
65 0.1
66 0.14
67 0.21
68 0.31
69 0.4
70 0.5
71 0.58
72 0.6
73 0.69
74 0.74
75 0.71
76 0.68
77 0.68
78 0.61
79 0.57
80 0.55
81 0.44
82 0.35
83 0.3
84 0.23
85 0.13
86 0.11
87 0.06
88 0.06
89 0.05
90 0.08
91 0.11
92 0.13
93 0.18
94 0.22
95 0.28
96 0.37
97 0.47
98 0.5
99 0.56
100 0.59
101 0.6
102 0.6
103 0.58
104 0.53
105 0.49
106 0.46
107 0.42
108 0.39
109 0.31
110 0.29
111 0.25
112 0.22
113 0.18
114 0.15
115 0.11
116 0.1
117 0.12
118 0.12
119 0.11
120 0.11
121 0.11
122 0.11
123 0.2
124 0.25
125 0.31
126 0.36
127 0.46
128 0.55
129 0.66
130 0.75
131 0.76
132 0.8
133 0.83
134 0.87
135 0.87
136 0.86
137 0.81
138 0.74
139 0.68
140 0.64
141 0.55
142 0.45
143 0.35
144 0.26