Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9X6K0

Protein Details
Accession F9X6K0   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
676-697DDKGEKGEKKEKKKDKHSETSABasic
NLS Segment(s)
PositionSequence
661-691TKVQIKPMFKKPKAKDDKGEKGEKKEKKKDK
Subcellular Location(s) mito 17, cyto 7, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011761  ATP-grasp  
IPR000560  His_Pase_clade-2  
IPR037446  His_Pase_VIP1  
IPR029033  His_PPase_superfam  
IPR040557  VIP1_N  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005856  C:cytoskeleton  
GO:0051537  F:2 iron, 2 sulfur cluster binding  
GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0033857  F:diphosphoinositol-pentakisphosphate kinase activity  
GO:0000829  F:inositol heptakisphosphate kinase activity  
GO:0052723  F:inositol hexakisphosphate 1-kinase activity  
GO:0052724  F:inositol hexakisphosphate 3-kinase activity  
GO:0000830  F:inositol hexakisphosphate 4-kinase activity  
GO:0000832  F:inositol hexakisphosphate 5-kinase activity  
GO:0000831  F:inositol hexakisphosphate 6-kinase activity  
GO:0000827  F:inositol-1,3,4,5,6-pentakisphosphate kinase activity  
GO:0052846  F:inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 1-diphosphatase activity  
GO:0052843  F:inositol-1-diphosphate-2,3,4,5,6-pentakisphosphate diphosphatase activity  
GO:0052845  F:inositol-5-diphosphate-1,2,3,4,6-pentakisphosphate diphosphatase activity  
GO:0046872  F:metal ion binding  
GO:0006020  P:inositol metabolic process  
GO:0032958  P:inositol phosphate biosynthetic process  
GO:0090307  P:mitotic spindle assembly  
GO:0016310  P:phosphorylation  
GO:0051516  P:regulation of bipolar cell growth  
GO:0110162  P:regulation of mitotic spindle elongation (spindle phase three)  
KEGG ztr:MYCGRDRAFT_37885  -  
Pfam View protein in Pfam  
PF00328  His_Phos_2  
PF18086  PPIP5K2_N  
PROSITE View protein in PROSITE  
PS50975  ATP_GRASP  
Amino Acid Sequences MSQSSASIASTTTSPASPVQAPNPPPARPARSVRGREPANSRRVSNSGLTSASHSAERSTASTNPNKIGTIGICALDAKARSKPSRNILNRLVGKDNEFDVIIFGDKVILDENVENWPVCDFLISFFSDGFPLEKAIAYAKLRKPFCVNDLPMQTILWDRRMCLGILDKLGVPTPPRLEVNRDGGPVALTSDIAQRMQQLTGVYLIGSDDGRGGGLPPPNDVHMEDDDDTLVVDGMKLRKPFVEKPTSGEDHNINVYYPKSQGGGGRRLFRKVNNKSSEKDADLIVPRAITEPDGSYIYEQFLKVENAEDVKAYTVGPEFCHAETRKSPVVDGVVKRNPNGKEIRYVTKLTPEEQTMAAKIATGFGQQVCGFDLLRVEGSGKMESYVIDVNGWSFVKDNNDYYDQAARVLKAMFIKEKQRWEAARAAATDFDEASRSMPPPTSVPTSIYKNANLSKESVRTVGGHREAMKTILRPRSVSQLRDKVHSAAHRVGHPHRTRSPSAATPPISSPPSLERDLATPQYGPLVATDEQMLPPPAVPANGASADDRPRSAGLESVAMSEPPSALPAPAPKSQWKLKGMVAVIRHADRTPKQKFKFTFHTKPFVDLLKGHQEEVLLVGEAALHSVQQAVRLAMAEGVEDMAKLRTLQNALSKKGAWPGTKVQIKPMFKKPKAKDDKGEKGEKKEKKKDKHSETSAVDGAPDHHLAPKPAEEDLALARAQTRNDSLGEITMSRAAAADNNLVLDKLQLVMKWGGEPTHSARYQATDLGENMRNDLLLMNRSVLDNVHIYTSSERRVTTSAQIFAAAFLDEKEVDEKRITVRKDLLDDSNAAKDEMDKVKKKLKGLLRQGHQAPEQFAWPKDGTPEPFLVVRRVVDLMKFHRRVMRNNFSKLQDPMATPNGLANGANATDAMALQIQPRWCTGEDAELFKERWEKLFNEFTDAEKVDPSKISELYDTMKFDALHNRQFLEWVFTPSKTILAEEEGADDGAGLERTLSQIAREEFGETHQGLAPIKVKNDARLEKLNEMYNLSKILFDFIGPQEYGITNSEKLEIGLLTSLPLLKEIVQDLEEVQASDDARSFLYFTKESHIYTLLNTILEGGVATKIARNAIPELDYLSQICFELYESENPIPIDPTHDGQAGDEEHEHFNYSIRITISPGCHTFDPLDVQLDSKHCIGCAPRRSLTSHGEWKEVLETLRAKFHTVKLPKSFTAVDLRERFSIGGNGSGGAGAEKKQEKEGGKGEAVLPPAMGQEQEVVLPPALL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.18
4 0.22
5 0.25
6 0.29
7 0.35
8 0.37
9 0.45
10 0.49
11 0.46
12 0.46
13 0.5
14 0.52
15 0.51
16 0.56
17 0.57
18 0.62
19 0.69
20 0.7
21 0.72
22 0.69
23 0.68
24 0.71
25 0.69
26 0.69
27 0.66
28 0.61
29 0.57
30 0.57
31 0.54
32 0.49
33 0.44
34 0.37
35 0.34
36 0.33
37 0.32
38 0.31
39 0.28
40 0.25
41 0.21
42 0.19
43 0.19
44 0.2
45 0.19
46 0.2
47 0.23
48 0.29
49 0.36
50 0.39
51 0.42
52 0.42
53 0.4
54 0.37
55 0.35
56 0.28
57 0.26
58 0.23
59 0.2
60 0.18
61 0.18
62 0.18
63 0.17
64 0.19
65 0.17
66 0.21
67 0.28
68 0.35
69 0.43
70 0.51
71 0.56
72 0.66
73 0.7
74 0.73
75 0.72
76 0.75
77 0.73
78 0.69
79 0.66
80 0.57
81 0.52
82 0.46
83 0.41
84 0.32
85 0.26
86 0.21
87 0.16
88 0.15
89 0.13
90 0.11
91 0.09
92 0.09
93 0.08
94 0.09
95 0.09
96 0.08
97 0.09
98 0.1
99 0.11
100 0.13
101 0.15
102 0.14
103 0.13
104 0.13
105 0.12
106 0.11
107 0.11
108 0.08
109 0.09
110 0.12
111 0.12
112 0.12
113 0.12
114 0.13
115 0.12
116 0.13
117 0.12
118 0.1
119 0.1
120 0.1
121 0.1
122 0.1
123 0.12
124 0.17
125 0.19
126 0.28
127 0.33
128 0.41
129 0.42
130 0.45
131 0.49
132 0.48
133 0.51
134 0.51
135 0.5
136 0.49
137 0.52
138 0.52
139 0.46
140 0.41
141 0.35
142 0.32
143 0.3
144 0.28
145 0.25
146 0.23
147 0.27
148 0.28
149 0.27
150 0.25
151 0.28
152 0.25
153 0.26
154 0.26
155 0.23
156 0.22
157 0.23
158 0.21
159 0.17
160 0.18
161 0.19
162 0.21
163 0.24
164 0.26
165 0.32
166 0.36
167 0.41
168 0.4
169 0.38
170 0.35
171 0.32
172 0.3
173 0.23
174 0.19
175 0.12
176 0.08
177 0.08
178 0.12
179 0.13
180 0.13
181 0.13
182 0.15
183 0.16
184 0.16
185 0.18
186 0.14
187 0.14
188 0.14
189 0.14
190 0.1
191 0.09
192 0.09
193 0.08
194 0.07
195 0.06
196 0.06
197 0.05
198 0.06
199 0.06
200 0.07
201 0.1
202 0.14
203 0.14
204 0.16
205 0.17
206 0.18
207 0.2
208 0.2
209 0.19
210 0.17
211 0.21
212 0.2
213 0.19
214 0.18
215 0.16
216 0.15
217 0.11
218 0.1
219 0.06
220 0.05
221 0.08
222 0.11
223 0.16
224 0.17
225 0.17
226 0.21
227 0.27
228 0.34
229 0.4
230 0.46
231 0.43
232 0.47
233 0.54
234 0.53
235 0.48
236 0.44
237 0.37
238 0.3
239 0.32
240 0.28
241 0.2
242 0.19
243 0.19
244 0.17
245 0.17
246 0.15
247 0.13
248 0.14
249 0.19
250 0.24
251 0.32
252 0.35
253 0.42
254 0.43
255 0.47
256 0.49
257 0.51
258 0.56
259 0.56
260 0.62
261 0.62
262 0.65
263 0.63
264 0.68
265 0.65
266 0.56
267 0.48
268 0.38
269 0.34
270 0.33
271 0.32
272 0.25
273 0.19
274 0.18
275 0.18
276 0.17
277 0.13
278 0.11
279 0.1
280 0.11
281 0.13
282 0.13
283 0.13
284 0.13
285 0.14
286 0.14
287 0.13
288 0.12
289 0.13
290 0.14
291 0.13
292 0.14
293 0.14
294 0.14
295 0.14
296 0.13
297 0.11
298 0.11
299 0.11
300 0.1
301 0.09
302 0.1
303 0.1
304 0.11
305 0.13
306 0.14
307 0.14
308 0.22
309 0.22
310 0.25
311 0.27
312 0.32
313 0.34
314 0.33
315 0.33
316 0.27
317 0.31
318 0.32
319 0.33
320 0.35
321 0.37
322 0.37
323 0.39
324 0.43
325 0.39
326 0.39
327 0.42
328 0.36
329 0.38
330 0.42
331 0.47
332 0.44
333 0.46
334 0.41
335 0.43
336 0.43
337 0.35
338 0.34
339 0.29
340 0.27
341 0.25
342 0.25
343 0.17
344 0.17
345 0.15
346 0.12
347 0.11
348 0.1
349 0.09
350 0.08
351 0.09
352 0.08
353 0.11
354 0.1
355 0.11
356 0.11
357 0.11
358 0.11
359 0.1
360 0.1
361 0.08
362 0.08
363 0.08
364 0.08
365 0.09
366 0.1
367 0.11
368 0.1
369 0.1
370 0.1
371 0.1
372 0.11
373 0.1
374 0.09
375 0.08
376 0.08
377 0.08
378 0.1
379 0.1
380 0.08
381 0.07
382 0.09
383 0.13
384 0.15
385 0.16
386 0.18
387 0.21
388 0.21
389 0.23
390 0.25
391 0.21
392 0.22
393 0.21
394 0.17
395 0.16
396 0.16
397 0.16
398 0.14
399 0.16
400 0.17
401 0.2
402 0.27
403 0.3
404 0.36
405 0.37
406 0.41
407 0.4
408 0.4
409 0.43
410 0.38
411 0.36
412 0.31
413 0.29
414 0.24
415 0.23
416 0.2
417 0.14
418 0.11
419 0.09
420 0.08
421 0.09
422 0.09
423 0.09
424 0.1
425 0.1
426 0.11
427 0.12
428 0.16
429 0.19
430 0.18
431 0.2
432 0.23
433 0.27
434 0.31
435 0.31
436 0.29
437 0.3
438 0.33
439 0.33
440 0.29
441 0.28
442 0.27
443 0.27
444 0.27
445 0.23
446 0.2
447 0.19
448 0.21
449 0.24
450 0.23
451 0.23
452 0.23
453 0.24
454 0.24
455 0.24
456 0.24
457 0.2
458 0.25
459 0.29
460 0.28
461 0.28
462 0.29
463 0.37
464 0.4
465 0.41
466 0.43
467 0.45
468 0.45
469 0.47
470 0.47
471 0.38
472 0.38
473 0.36
474 0.32
475 0.29
476 0.29
477 0.28
478 0.31
479 0.33
480 0.39
481 0.39
482 0.41
483 0.42
484 0.45
485 0.45
486 0.44
487 0.45
488 0.39
489 0.4
490 0.4
491 0.36
492 0.32
493 0.31
494 0.31
495 0.28
496 0.24
497 0.21
498 0.18
499 0.21
500 0.21
501 0.2
502 0.17
503 0.18
504 0.21
505 0.2
506 0.18
507 0.13
508 0.12
509 0.12
510 0.12
511 0.1
512 0.07
513 0.1
514 0.09
515 0.09
516 0.11
517 0.1
518 0.1
519 0.11
520 0.11
521 0.08
522 0.07
523 0.08
524 0.07
525 0.06
526 0.06
527 0.06
528 0.07
529 0.08
530 0.08
531 0.08
532 0.1
533 0.13
534 0.13
535 0.13
536 0.12
537 0.12
538 0.12
539 0.12
540 0.11
541 0.09
542 0.1
543 0.1
544 0.11
545 0.11
546 0.1
547 0.1
548 0.08
549 0.08
550 0.06
551 0.07
552 0.05
553 0.05
554 0.06
555 0.1
556 0.14
557 0.16
558 0.19
559 0.21
560 0.26
561 0.31
562 0.36
563 0.35
564 0.34
565 0.32
566 0.34
567 0.32
568 0.31
569 0.27
570 0.22
571 0.22
572 0.19
573 0.19
574 0.15
575 0.18
576 0.18
577 0.26
578 0.32
579 0.4
580 0.42
581 0.49
582 0.52
583 0.54
584 0.61
585 0.61
586 0.63
587 0.57
588 0.63
589 0.56
590 0.56
591 0.51
592 0.42
593 0.34
594 0.25
595 0.24
596 0.25
597 0.25
598 0.23
599 0.21
600 0.19
601 0.18
602 0.18
603 0.15
604 0.06
605 0.05
606 0.05
607 0.04
608 0.04
609 0.04
610 0.03
611 0.02
612 0.02
613 0.04
614 0.04
615 0.05
616 0.06
617 0.06
618 0.06
619 0.06
620 0.06
621 0.06
622 0.06
623 0.04
624 0.04
625 0.04
626 0.04
627 0.04
628 0.04
629 0.03
630 0.04
631 0.04
632 0.05
633 0.07
634 0.08
635 0.1
636 0.17
637 0.2
638 0.22
639 0.23
640 0.22
641 0.21
642 0.26
643 0.29
644 0.22
645 0.22
646 0.25
647 0.32
648 0.36
649 0.36
650 0.37
651 0.4
652 0.43
653 0.45
654 0.51
655 0.54
656 0.53
657 0.63
658 0.6
659 0.63
660 0.7
661 0.69
662 0.67
663 0.66
664 0.72
665 0.68
666 0.74
667 0.65
668 0.64
669 0.69
670 0.67
671 0.67
672 0.68
673 0.71
674 0.71
675 0.79
676 0.81
677 0.81
678 0.84
679 0.8
680 0.77
681 0.69
682 0.64
683 0.54
684 0.43
685 0.34
686 0.24
687 0.2
688 0.13
689 0.12
690 0.09
691 0.1
692 0.11
693 0.12
694 0.13
695 0.13
696 0.13
697 0.12
698 0.12
699 0.1
700 0.1
701 0.1
702 0.1
703 0.08
704 0.07
705 0.08
706 0.1
707 0.1
708 0.1
709 0.11
710 0.11
711 0.11
712 0.12
713 0.11
714 0.1
715 0.1
716 0.09
717 0.08
718 0.08
719 0.07
720 0.06
721 0.06
722 0.06
723 0.06
724 0.07
725 0.07
726 0.06
727 0.07
728 0.07
729 0.07
730 0.06
731 0.05
732 0.05
733 0.05
734 0.05
735 0.05
736 0.08
737 0.09
738 0.09
739 0.1
740 0.1
741 0.09
742 0.09
743 0.12
744 0.13
745 0.19
746 0.19
747 0.2
748 0.2
749 0.22
750 0.22
751 0.22
752 0.19
753 0.13
754 0.14
755 0.17
756 0.21
757 0.19
758 0.18
759 0.16
760 0.15
761 0.14
762 0.14
763 0.11
764 0.08
765 0.09
766 0.08
767 0.09
768 0.09
769 0.09
770 0.08
771 0.09
772 0.08
773 0.08
774 0.08
775 0.08
776 0.09
777 0.11
778 0.13
779 0.15
780 0.15
781 0.15
782 0.16
783 0.18
784 0.19
785 0.23
786 0.24
787 0.23
788 0.22
789 0.22
790 0.2
791 0.19
792 0.17
793 0.11
794 0.07
795 0.05
796 0.06
797 0.06
798 0.06
799 0.09
800 0.09
801 0.1
802 0.11
803 0.12
804 0.16
805 0.22
806 0.23
807 0.24
808 0.28
809 0.29
810 0.32
811 0.34
812 0.31
813 0.26
814 0.27
815 0.25
816 0.23
817 0.21
818 0.17
819 0.15
820 0.13
821 0.17
822 0.22
823 0.28
824 0.29
825 0.33
826 0.4
827 0.44
828 0.45
829 0.48
830 0.49
831 0.52
832 0.59
833 0.63
834 0.6
835 0.64
836 0.64
837 0.6
838 0.54
839 0.46
840 0.37
841 0.29
842 0.29
843 0.25
844 0.23
845 0.23
846 0.21
847 0.19
848 0.2
849 0.23
850 0.22
851 0.22
852 0.23
853 0.19
854 0.22
855 0.23
856 0.21
857 0.19
858 0.17
859 0.15
860 0.16
861 0.15
862 0.14
863 0.17
864 0.22
865 0.31
866 0.32
867 0.33
868 0.38
869 0.42
870 0.49
871 0.54
872 0.58
873 0.56
874 0.6
875 0.64
876 0.59
877 0.6
878 0.52
879 0.46
880 0.39
881 0.33
882 0.31
883 0.29
884 0.27
885 0.22
886 0.22
887 0.18
888 0.16
889 0.14
890 0.1
891 0.08
892 0.07
893 0.07
894 0.06
895 0.06
896 0.05
897 0.05
898 0.05
899 0.05
900 0.05
901 0.06
902 0.1
903 0.11
904 0.11
905 0.12
906 0.15
907 0.15
908 0.17
909 0.17
910 0.22
911 0.23
912 0.26
913 0.27
914 0.27
915 0.26
916 0.25
917 0.29
918 0.22
919 0.23
920 0.23
921 0.23
922 0.26
923 0.34
924 0.33
925 0.34
926 0.34
927 0.32
928 0.34
929 0.33
930 0.28
931 0.22
932 0.22
933 0.18
934 0.18
935 0.19
936 0.17
937 0.17
938 0.18
939 0.17
940 0.18
941 0.19
942 0.21
943 0.21
944 0.18
945 0.2
946 0.19
947 0.2
948 0.28
949 0.3
950 0.32
951 0.32
952 0.32
953 0.29
954 0.31
955 0.29
956 0.26
957 0.23
958 0.24
959 0.24
960 0.23
961 0.25
962 0.24
963 0.25
964 0.18
965 0.18
966 0.13
967 0.13
968 0.14
969 0.13
970 0.14
971 0.12
972 0.12
973 0.11
974 0.09
975 0.07
976 0.06
977 0.06
978 0.05
979 0.04
980 0.05
981 0.06
982 0.07
983 0.07
984 0.07
985 0.13
986 0.14
987 0.15
988 0.16
989 0.17
990 0.16
991 0.18
992 0.22
993 0.16
994 0.17
995 0.17
996 0.18
997 0.16
998 0.19
999 0.22
1000 0.19
1001 0.2
1002 0.25
1003 0.25
1004 0.3
1005 0.38
1006 0.4
1007 0.41
1008 0.46
1009 0.49
1010 0.48
1011 0.5
1012 0.47
1013 0.4
1014 0.39
1015 0.35
1016 0.29
1017 0.26
1018 0.22
1019 0.19
1020 0.15
1021 0.17
1022 0.13
1023 0.12
1024 0.14
1025 0.14
1026 0.17
1027 0.16
1028 0.16
1029 0.15
1030 0.15
1031 0.17
1032 0.15
1033 0.17
1034 0.14
1035 0.15
1036 0.16
1037 0.15
1038 0.14
1039 0.14
1040 0.11
1041 0.09
1042 0.09
1043 0.09
1044 0.07
1045 0.08
1046 0.09
1047 0.07
1048 0.08
1049 0.08
1050 0.08
1051 0.1
1052 0.11
1053 0.12
1054 0.12
1055 0.12
1056 0.12
1057 0.13
1058 0.13
1059 0.11
1060 0.11
1061 0.11
1062 0.11
1063 0.11
1064 0.12
1065 0.1
1066 0.11
1067 0.11
1068 0.11
1069 0.12
1070 0.17
1071 0.17
1072 0.17
1073 0.23
1074 0.25
1075 0.25
1076 0.26
1077 0.26
1078 0.22
1079 0.21
1080 0.24
1081 0.19
1082 0.17
1083 0.16
1084 0.14
1085 0.11
1086 0.1
1087 0.09
1088 0.06
1089 0.05
1090 0.06
1091 0.06
1092 0.08
1093 0.09
1094 0.11
1095 0.12
1096 0.13
1097 0.16
1098 0.17
1099 0.19
1100 0.17
1101 0.2
1102 0.19
1103 0.19
1104 0.17
1105 0.16
1106 0.14
1107 0.13
1108 0.12
1109 0.09
1110 0.08
1111 0.11
1112 0.13
1113 0.16
1114 0.2
1115 0.2
1116 0.23
1117 0.23
1118 0.23
1119 0.21
1120 0.19
1121 0.21
1122 0.19
1123 0.21
1124 0.22
1125 0.23
1126 0.23
1127 0.21
1128 0.25
1129 0.2
1130 0.19
1131 0.19
1132 0.18
1133 0.19
1134 0.19
1135 0.21
1136 0.17
1137 0.18
1138 0.18
1139 0.17
1140 0.18
1141 0.18
1142 0.18
1143 0.19
1144 0.24
1145 0.25
1146 0.29
1147 0.3
1148 0.3
1149 0.29
1150 0.31
1151 0.29
1152 0.26
1153 0.28
1154 0.24
1155 0.25
1156 0.21
1157 0.22
1158 0.23
1159 0.24
1160 0.24
1161 0.22
1162 0.21
1163 0.17
1164 0.2
1165 0.26
1166 0.31
1167 0.38
1168 0.43
1169 0.44
1170 0.47
1171 0.51
1172 0.53
1173 0.53
1174 0.53
1175 0.54
1176 0.49
1177 0.48
1178 0.46
1179 0.44
1180 0.4
1181 0.36
1182 0.28
1183 0.24
1184 0.25
1185 0.24
1186 0.31
1187 0.3
1188 0.32
1189 0.34
1190 0.39
1191 0.43
1192 0.46
1193 0.53
1194 0.55
1195 0.6
1196 0.57
1197 0.58
1198 0.53
1199 0.47
1200 0.5
1201 0.44
1202 0.45
1203 0.44
1204 0.46
1205 0.42
1206 0.42
1207 0.39
1208 0.31
1209 0.32
1210 0.24
1211 0.23
1212 0.2
1213 0.19
1214 0.18
1215 0.17
1216 0.15
1217 0.11
1218 0.11
1219 0.09
1220 0.16
1221 0.21
1222 0.22
1223 0.26
1224 0.33
1225 0.35
1226 0.41
1227 0.46
1228 0.45
1229 0.41
1230 0.42
1231 0.4
1232 0.37
1233 0.36
1234 0.28
1235 0.23
1236 0.16
1237 0.16
1238 0.15
1239 0.13
1240 0.1
1241 0.1
1242 0.1
1243 0.11
1244 0.12
1245 0.13