Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0U3Q8

Protein Details
Accession Q0U3Q8   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
230-261RGGLKRKRLASERWRARFKKGFKDVTRRVSELBasic
NLS Segment(s)
PositionSequence
226-252KYHERGGLKRKRLASERWRARFKKGFK
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 7.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0070124  P:mitochondrial translational initiation  
KEGG pno:SNOG_13606  -  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MSSRSLGELLLRPSPIARTPLCQIRRTPASWPSRSISNTPQAAAQSQGKEDDYDYRSQGQQKPASQAPQQQQPPIRRSPSGPRDTSKAIDSLFGMSSQRSRPPPRGQSTSSDEVRAARNAHIFGAGFSNPSGTNRRTGRGPPKLNFDDMSLPTDMLDPNLSNKPSEAASLATQQQETFANYPRLNPTYGRLVELDVSRGRDLVRGIGMLGSLVTRNKVKHEMFRQKYHERGGLKRKRLASERWRARFKKGFKDVTRRVSELTAKGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.26
4 0.24
5 0.25
6 0.31
7 0.4
8 0.45
9 0.46
10 0.45
11 0.49
12 0.53
13 0.51
14 0.51
15 0.51
16 0.55
17 0.54
18 0.55
19 0.49
20 0.5
21 0.51
22 0.49
23 0.47
24 0.46
25 0.44
26 0.4
27 0.4
28 0.34
29 0.32
30 0.31
31 0.29
32 0.22
33 0.22
34 0.23
35 0.22
36 0.21
37 0.21
38 0.24
39 0.23
40 0.24
41 0.25
42 0.25
43 0.28
44 0.35
45 0.39
46 0.4
47 0.44
48 0.44
49 0.48
50 0.49
51 0.5
52 0.47
53 0.49
54 0.46
55 0.49
56 0.48
57 0.48
58 0.51
59 0.53
60 0.55
61 0.54
62 0.52
63 0.45
64 0.47
65 0.52
66 0.55
67 0.56
68 0.54
69 0.49
70 0.5
71 0.51
72 0.49
73 0.4
74 0.32
75 0.24
76 0.21
77 0.19
78 0.16
79 0.13
80 0.12
81 0.11
82 0.09
83 0.12
84 0.13
85 0.18
86 0.22
87 0.26
88 0.33
89 0.42
90 0.51
91 0.55
92 0.58
93 0.56
94 0.55
95 0.58
96 0.56
97 0.48
98 0.39
99 0.33
100 0.29
101 0.28
102 0.24
103 0.19
104 0.15
105 0.16
106 0.15
107 0.15
108 0.14
109 0.12
110 0.1
111 0.11
112 0.09
113 0.08
114 0.07
115 0.08
116 0.07
117 0.09
118 0.13
119 0.12
120 0.18
121 0.19
122 0.21
123 0.22
124 0.29
125 0.36
126 0.42
127 0.48
128 0.44
129 0.51
130 0.51
131 0.5
132 0.44
133 0.37
134 0.32
135 0.26
136 0.26
137 0.18
138 0.16
139 0.15
140 0.15
141 0.13
142 0.09
143 0.09
144 0.06
145 0.09
146 0.13
147 0.13
148 0.13
149 0.13
150 0.13
151 0.13
152 0.13
153 0.11
154 0.09
155 0.1
156 0.13
157 0.15
158 0.15
159 0.14
160 0.14
161 0.14
162 0.14
163 0.15
164 0.14
165 0.16
166 0.21
167 0.21
168 0.23
169 0.27
170 0.28
171 0.27
172 0.26
173 0.24
174 0.27
175 0.27
176 0.27
177 0.23
178 0.22
179 0.23
180 0.23
181 0.23
182 0.17
183 0.19
184 0.17
185 0.17
186 0.16
187 0.16
188 0.16
189 0.15
190 0.14
191 0.11
192 0.11
193 0.11
194 0.1
195 0.08
196 0.07
197 0.06
198 0.06
199 0.07
200 0.09
201 0.12
202 0.13
203 0.18
204 0.26
205 0.29
206 0.37
207 0.48
208 0.56
209 0.6
210 0.68
211 0.72
212 0.71
213 0.74
214 0.7
215 0.66
216 0.6
217 0.62
218 0.64
219 0.66
220 0.67
221 0.68
222 0.68
223 0.7
224 0.7
225 0.71
226 0.71
227 0.72
228 0.75
229 0.77
230 0.82
231 0.76
232 0.8
233 0.79
234 0.77
235 0.76
236 0.76
237 0.77
238 0.76
239 0.84
240 0.84
241 0.84
242 0.83
243 0.74
244 0.66
245 0.62
246 0.59