Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9WY91

Protein Details
Accession F9WY91   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
42-66SYETPDGKIRRRRKRKDIENEKAGEBasic
NLS Segment(s)
PositionSequence
49-57KIRRRRKRK
Subcellular Location(s) extr 10, mito 5, plas 4, golg 3, vacu 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ztr:MYCGRDRAFT_29317  -  
Amino Acid Sequences YLHPRSRTTGTLFTTTLAVSFIVVALPHLLPCPVDRRQFADSYETPDGKIRRRRKRKDIENEKAGESGSSAVGNAAASEDPPQRECPIPKPGGIVGQIMGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.27
3 0.22
4 0.15
5 0.11
6 0.07
7 0.06
8 0.06
9 0.05
10 0.05
11 0.05
12 0.06
13 0.06
14 0.06
15 0.06
16 0.06
17 0.07
18 0.08
19 0.13
20 0.17
21 0.21
22 0.22
23 0.27
24 0.3
25 0.31
26 0.31
27 0.32
28 0.28
29 0.3
30 0.32
31 0.27
32 0.25
33 0.27
34 0.29
35 0.29
36 0.38
37 0.42
38 0.49
39 0.6
40 0.69
41 0.76
42 0.84
43 0.87
44 0.9
45 0.91
46 0.89
47 0.86
48 0.79
49 0.69
50 0.58
51 0.47
52 0.36
53 0.25
54 0.16
55 0.09
56 0.07
57 0.06
58 0.05
59 0.06
60 0.06
61 0.05
62 0.05
63 0.04
64 0.05
65 0.09
66 0.12
67 0.14
68 0.16
69 0.18
70 0.2
71 0.26
72 0.3
73 0.32
74 0.39
75 0.39
76 0.38
77 0.4
78 0.39
79 0.38
80 0.36
81 0.31