Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9X8R4

Protein Details
Accession F9X8R4    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
123-149DMLLEGRKKREAKRQQKEQQRRIKEEDBasic
NLS Segment(s)
PositionSequence
129-144RKKREAKRQQKEQQRR
Subcellular Location(s) mito 17, mito_nucl 11.666, cyto_mito 11.166, cyto_nucl 5.166, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035213  DUF5321  
KEGG ztr:MYCGRDRAFT_28446  -  
Pfam View protein in Pfam  
PF17254  DUF5321  
Amino Acid Sequences LPRVANPSFWSSLIPRPFRRPVTEAEVIERALKRSAGAEERRTGIKFLVLGILVGSNAINLISIKRDMLNFTRQTDAKLELLREVVQKVKNGEDVDVKQALGTGDPEHEKEWEQVMKELEETDMLLEGRKKREAKRQQKEQQRRIKEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.43
3 0.49
4 0.56
5 0.58
6 0.61
7 0.56
8 0.53
9 0.54
10 0.55
11 0.49
12 0.45
13 0.42
14 0.36
15 0.37
16 0.32
17 0.25
18 0.2
19 0.19
20 0.15
21 0.16
22 0.19
23 0.23
24 0.28
25 0.31
26 0.32
27 0.34
28 0.36
29 0.35
30 0.31
31 0.24
32 0.2
33 0.16
34 0.13
35 0.13
36 0.1
37 0.09
38 0.08
39 0.08
40 0.06
41 0.05
42 0.05
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.04
49 0.05
50 0.05
51 0.06
52 0.07
53 0.07
54 0.1
55 0.12
56 0.19
57 0.2
58 0.21
59 0.24
60 0.24
61 0.25
62 0.24
63 0.23
64 0.18
65 0.18
66 0.16
67 0.14
68 0.14
69 0.14
70 0.14
71 0.12
72 0.15
73 0.15
74 0.17
75 0.18
76 0.18
77 0.21
78 0.2
79 0.21
80 0.21
81 0.2
82 0.22
83 0.21
84 0.19
85 0.15
86 0.16
87 0.14
88 0.1
89 0.1
90 0.07
91 0.09
92 0.11
93 0.12
94 0.12
95 0.13
96 0.14
97 0.14
98 0.18
99 0.18
100 0.18
101 0.21
102 0.22
103 0.21
104 0.2
105 0.19
106 0.15
107 0.13
108 0.12
109 0.09
110 0.08
111 0.08
112 0.1
113 0.14
114 0.18
115 0.23
116 0.3
117 0.35
118 0.41
119 0.52
120 0.61
121 0.68
122 0.74
123 0.81
124 0.83
125 0.89
126 0.93
127 0.93
128 0.92
129 0.91