Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UX47

Protein Details
Accession Q0UX47    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
19-40VDRHNSRRRTSHQSQRRYSRTEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
KEGG pno:SNOG_03667  -  
Amino Acid Sequences MCLVRVKETEEHVVPYRVVDRHNSRRRTSHQSQRRYSRTEIVHQESPRPSASYVAVPAPKPLPIPAPQPVPVFVQPPPAPIPAPAPPPPPSSHHGAAHYVEVSPRSSISSRSSSPPRSEYVYREREIRRERETGPQYDHYRYVEPQRSESEVGYARSRSRQRSMSRGGYEDPRGSFREERTRIVIEDERGGGGRRRDYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.32
4 0.27
5 0.27
6 0.31
7 0.38
8 0.46
9 0.56
10 0.61
11 0.6
12 0.67
13 0.72
14 0.73
15 0.73
16 0.73
17 0.73
18 0.77
19 0.81
20 0.83
21 0.83
22 0.79
23 0.73
24 0.7
25 0.65
26 0.63
27 0.62
28 0.58
29 0.58
30 0.53
31 0.56
32 0.49
33 0.47
34 0.4
35 0.34
36 0.27
37 0.23
38 0.23
39 0.19
40 0.19
41 0.2
42 0.21
43 0.2
44 0.22
45 0.2
46 0.19
47 0.18
48 0.17
49 0.17
50 0.17
51 0.21
52 0.22
53 0.25
54 0.28
55 0.28
56 0.28
57 0.28
58 0.26
59 0.24
60 0.2
61 0.25
62 0.21
63 0.23
64 0.24
65 0.21
66 0.2
67 0.19
68 0.22
69 0.17
70 0.21
71 0.21
72 0.22
73 0.23
74 0.26
75 0.27
76 0.28
77 0.27
78 0.29
79 0.3
80 0.29
81 0.28
82 0.27
83 0.26
84 0.23
85 0.2
86 0.14
87 0.11
88 0.1
89 0.09
90 0.08
91 0.07
92 0.08
93 0.08
94 0.11
95 0.14
96 0.17
97 0.18
98 0.23
99 0.29
100 0.3
101 0.33
102 0.33
103 0.31
104 0.32
105 0.33
106 0.33
107 0.37
108 0.39
109 0.37
110 0.42
111 0.42
112 0.46
113 0.5
114 0.5
115 0.46
116 0.44
117 0.45
118 0.49
119 0.52
120 0.47
121 0.46
122 0.47
123 0.46
124 0.45
125 0.45
126 0.37
127 0.35
128 0.33
129 0.37
130 0.38
131 0.36
132 0.36
133 0.37
134 0.38
135 0.37
136 0.35
137 0.3
138 0.26
139 0.27
140 0.26
141 0.25
142 0.24
143 0.31
144 0.37
145 0.38
146 0.41
147 0.47
148 0.5
149 0.57
150 0.63
151 0.64
152 0.61
153 0.58
154 0.55
155 0.53
156 0.52
157 0.47
158 0.41
159 0.35
160 0.34
161 0.36
162 0.36
163 0.37
164 0.43
165 0.43
166 0.45
167 0.47
168 0.48
169 0.43
170 0.46
171 0.44
172 0.36
173 0.36
174 0.33
175 0.28
176 0.27
177 0.28
178 0.27
179 0.27