Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9XBW3

Protein Details
Accession F9XBW3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
45-65KEDHVSRRPPYRRRRWQVGMLBasic
NLS Segment(s)
Subcellular Location(s) plas 23, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008521  Mg_trans_NIPA  
Gene Ontology GO:0016020  C:membrane  
GO:0015095  F:magnesium ion transmembrane transporter activity  
KEGG ztr:MYCGRDRAFT_104455  -  
Pfam View protein in Pfam  
PF05653  Mg_trans_NIPA  
Amino Acid Sequences MDDAKTQMSPEGAMAIGIIVGLLSTCVQSVGLTLQRKSHMLEDEKEDHVSRRPPYRRRRWQVGMLLFLVANIIGSTIQIVSLPLPLLSTLQASGLVFNSVMASLLLKEPWTLRTAYGTILVAAGAILISYFSAMPEPSHDLQQLLHLLSMRGFLVWFILSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.06
4 0.05
5 0.04
6 0.02
7 0.02
8 0.02
9 0.03
10 0.03
11 0.03
12 0.04
13 0.04
14 0.04
15 0.04
16 0.05
17 0.09
18 0.14
19 0.18
20 0.19
21 0.22
22 0.24
23 0.25
24 0.26
25 0.27
26 0.28
27 0.29
28 0.31
29 0.34
30 0.36
31 0.36
32 0.36
33 0.32
34 0.27
35 0.28
36 0.3
37 0.28
38 0.34
39 0.41
40 0.49
41 0.59
42 0.69
43 0.76
44 0.79
45 0.84
46 0.8
47 0.8
48 0.79
49 0.71
50 0.62
51 0.51
52 0.43
53 0.33
54 0.27
55 0.18
56 0.1
57 0.06
58 0.03
59 0.03
60 0.02
61 0.02
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.05
76 0.04
77 0.05
78 0.05
79 0.05
80 0.06
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.04
87 0.05
88 0.04
89 0.04
90 0.04
91 0.05
92 0.05
93 0.05
94 0.06
95 0.07
96 0.08
97 0.1
98 0.1
99 0.1
100 0.13
101 0.13
102 0.13
103 0.14
104 0.13
105 0.12
106 0.11
107 0.1
108 0.07
109 0.06
110 0.05
111 0.03
112 0.02
113 0.02
114 0.02
115 0.02
116 0.03
117 0.03
118 0.03
119 0.05
120 0.05
121 0.06
122 0.09
123 0.16
124 0.16
125 0.19
126 0.2
127 0.2
128 0.2
129 0.23
130 0.23
131 0.17
132 0.17
133 0.15
134 0.15
135 0.15
136 0.16
137 0.12
138 0.1
139 0.09
140 0.08
141 0.09