Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9XG74

Protein Details
Accession F9XG74   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
99-120GLLRQNERKQKKKLAERDKVDFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012479  SAP30BP  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
KEGG ztr:MYCGRDRAFT_94584  -  
Pfam View protein in Pfam  
PF07818  HCNGP  
Amino Acid Sequences MPTMPNFDIPDSPPPPPVNSEEAAVLAATTKKIERFLELKKKGVHFNERLQNSTSLRNPSLLPKLMQFADITREDSYRSSLPEGLGISVTWPEECYVEGLLRQNERKQKKKLAERDKVDFVPAVAKDEAKAQVQSAASEVGSGKKSRFDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.34
4 0.35
5 0.32
6 0.29
7 0.29
8 0.24
9 0.22
10 0.2
11 0.16
12 0.12
13 0.09
14 0.08
15 0.08
16 0.08
17 0.1
18 0.11
19 0.15
20 0.16
21 0.19
22 0.23
23 0.33
24 0.43
25 0.44
26 0.49
27 0.5
28 0.52
29 0.54
30 0.56
31 0.55
32 0.49
33 0.54
34 0.56
35 0.53
36 0.52
37 0.48
38 0.46
39 0.38
40 0.38
41 0.34
42 0.3
43 0.29
44 0.28
45 0.26
46 0.27
47 0.29
48 0.26
49 0.23
50 0.19
51 0.21
52 0.2
53 0.2
54 0.15
55 0.11
56 0.14
57 0.14
58 0.14
59 0.13
60 0.13
61 0.13
62 0.13
63 0.15
64 0.12
65 0.12
66 0.12
67 0.12
68 0.12
69 0.13
70 0.13
71 0.1
72 0.09
73 0.08
74 0.07
75 0.07
76 0.07
77 0.05
78 0.05
79 0.05
80 0.05
81 0.06
82 0.06
83 0.07
84 0.07
85 0.08
86 0.12
87 0.14
88 0.18
89 0.2
90 0.25
91 0.34
92 0.43
93 0.5
94 0.54
95 0.61
96 0.67
97 0.75
98 0.8
99 0.82
100 0.83
101 0.8
102 0.79
103 0.76
104 0.66
105 0.58
106 0.47
107 0.37
108 0.32
109 0.26
110 0.24
111 0.18
112 0.18
113 0.17
114 0.2
115 0.23
116 0.19
117 0.2
118 0.16
119 0.2
120 0.2
121 0.2
122 0.18
123 0.16
124 0.13
125 0.14
126 0.14
127 0.14
128 0.16
129 0.18
130 0.18