Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9XRS0

Protein Details
Accession F9XRS0    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
106-125GETTRRRWQRHLDPNRNGKEBasic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001005  SANT/Myb  
KEGG ztr:MYCGRDRAFT_97915  -  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
CDD cd00167  SANT  
Amino Acid Sequences MSPNRRNSDLSQASSTPLERARHEAASNNDFGTGYDSDPDDLFLVHPATVLMVDKKKKAAAPRNVFTTEEEDQVILDNFKQYPKGMNIPFTNRYEMMKNSLLGRSGETTRRRWQRHLDPNRNGKEIQAKEERDSKRQRFLQHLAKSHLKDPDMGLDDRVKTVEESTGDATNRSAIVAGIKHLRAEGIISKNLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.31
4 0.3
5 0.29
6 0.26
7 0.32
8 0.33
9 0.35
10 0.35
11 0.38
12 0.39
13 0.4
14 0.39
15 0.33
16 0.29
17 0.25
18 0.24
19 0.22
20 0.16
21 0.12
22 0.13
23 0.13
24 0.13
25 0.13
26 0.14
27 0.1
28 0.09
29 0.09
30 0.09
31 0.09
32 0.08
33 0.08
34 0.07
35 0.07
36 0.07
37 0.08
38 0.1
39 0.15
40 0.18
41 0.2
42 0.22
43 0.25
44 0.27
45 0.36
46 0.42
47 0.46
48 0.53
49 0.55
50 0.58
51 0.57
52 0.55
53 0.47
54 0.43
55 0.33
56 0.26
57 0.22
58 0.17
59 0.15
60 0.15
61 0.13
62 0.08
63 0.07
64 0.07
65 0.07
66 0.08
67 0.09
68 0.09
69 0.12
70 0.14
71 0.21
72 0.2
73 0.25
74 0.27
75 0.31
76 0.35
77 0.33
78 0.32
79 0.26
80 0.26
81 0.24
82 0.22
83 0.22
84 0.19
85 0.18
86 0.17
87 0.17
88 0.17
89 0.15
90 0.15
91 0.13
92 0.14
93 0.2
94 0.22
95 0.26
96 0.33
97 0.42
98 0.45
99 0.48
100 0.54
101 0.58
102 0.66
103 0.73
104 0.74
105 0.74
106 0.8
107 0.79
108 0.73
109 0.62
110 0.53
111 0.52
112 0.43
113 0.4
114 0.39
115 0.36
116 0.37
117 0.45
118 0.46
119 0.45
120 0.54
121 0.52
122 0.53
123 0.57
124 0.58
125 0.58
126 0.62
127 0.64
128 0.61
129 0.63
130 0.59
131 0.61
132 0.59
133 0.55
134 0.52
135 0.43
136 0.37
137 0.32
138 0.33
139 0.31
140 0.29
141 0.27
142 0.26
143 0.26
144 0.25
145 0.24
146 0.18
147 0.14
148 0.15
149 0.16
150 0.13
151 0.16
152 0.17
153 0.21
154 0.21
155 0.2
156 0.2
157 0.18
158 0.17
159 0.14
160 0.12
161 0.08
162 0.11
163 0.11
164 0.14
165 0.18
166 0.19
167 0.19
168 0.19
169 0.19
170 0.16
171 0.18
172 0.22
173 0.22