Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9XJS5

Protein Details
Accession F9XJS5   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-22DIQARFKRKDRVEPKLQEKATHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto 9, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002867  IBR_dom  
Gene Ontology GO:0046872  F:metal ion binding  
KEGG ztr:MYCGRDRAFT_95492  -  
Pfam View protein in Pfam  
PF01485  IBR  
CDD cd20335  BRcat_RBR  
Amino Acid Sequences MDIQARFKRKDRVEPKLQEKATMAFLRSQPDFVSCPSSTCKDGASMADGNIFTCRTCQYRYCFACNVPFHEDEGCQEFQDRIQEDERKTLEIAESLEEVSPTGTRCKYQYCWLCFAEQRDILRIGNHMHERDCKHWRHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.81
4 0.75
5 0.67
6 0.6
7 0.52
8 0.49
9 0.41
10 0.34
11 0.29
12 0.3
13 0.31
14 0.3
15 0.28
16 0.22
17 0.22
18 0.22
19 0.19
20 0.23
21 0.19
22 0.2
23 0.23
24 0.25
25 0.24
26 0.23
27 0.22
28 0.17
29 0.18
30 0.16
31 0.17
32 0.15
33 0.13
34 0.15
35 0.14
36 0.13
37 0.13
38 0.12
39 0.08
40 0.08
41 0.1
42 0.11
43 0.13
44 0.17
45 0.21
46 0.31
47 0.34
48 0.37
49 0.37
50 0.36
51 0.41
52 0.38
53 0.37
54 0.31
55 0.29
56 0.25
57 0.24
58 0.23
59 0.16
60 0.19
61 0.15
62 0.12
63 0.12
64 0.11
65 0.11
66 0.15
67 0.15
68 0.13
69 0.17
70 0.22
71 0.23
72 0.28
73 0.28
74 0.25
75 0.25
76 0.23
77 0.19
78 0.15
79 0.15
80 0.1
81 0.1
82 0.09
83 0.09
84 0.08
85 0.08
86 0.07
87 0.07
88 0.07
89 0.11
90 0.12
91 0.13
92 0.16
93 0.21
94 0.24
95 0.32
96 0.4
97 0.41
98 0.46
99 0.46
100 0.48
101 0.46
102 0.47
103 0.45
104 0.4
105 0.37
106 0.35
107 0.36
108 0.32
109 0.3
110 0.28
111 0.24
112 0.27
113 0.31
114 0.3
115 0.31
116 0.38
117 0.42
118 0.47
119 0.53