Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F9XN59

Protein Details
Accession F9XN59    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
65-90DGPVSAKKPAKVKRRQKEGRNGKKGGBasic
NLS Segment(s)
PositionSequence
68-90VSAKKPAKVKRRQKEGRNGKKGG
Subcellular Location(s) mito 22, nucl 2, cyto 1, extr 1, pero 1, cyto_pero 1
Family & Domain DBs
KEGG ztr:MYCGRDRAFT_29441  -  
Amino Acid Sequences KPCTLCGIPRPVLVRCKIDETAKWHMVCPGKCWISVSGGQEDARGHEAEHPFYKYGGMWKNKHADGPVSAKKPAKVKRRQKEGRNGKKGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.38
3 0.41
4 0.4
5 0.4
6 0.4
7 0.39
8 0.43
9 0.44
10 0.42
11 0.37
12 0.4
13 0.43
14 0.39
15 0.35
16 0.35
17 0.3
18 0.3
19 0.31
20 0.27
21 0.24
22 0.27
23 0.26
24 0.19
25 0.2
26 0.19
27 0.19
28 0.17
29 0.15
30 0.13
31 0.11
32 0.1
33 0.13
34 0.14
35 0.15
36 0.17
37 0.17
38 0.16
39 0.16
40 0.16
41 0.12
42 0.17
43 0.23
44 0.28
45 0.29
46 0.34
47 0.4
48 0.4
49 0.41
50 0.36
51 0.31
52 0.29
53 0.35
54 0.37
55 0.34
56 0.38
57 0.39
58 0.41
59 0.48
60 0.52
61 0.54
62 0.58
63 0.66
64 0.72
65 0.81
66 0.87
67 0.88
68 0.91
69 0.92
70 0.92